dbPTM

CDK8_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CDK8_CAEEL
UniProt AC	P90866
Protein Name	Cyclin-dependent kinase 8
Gene Name	cdk-8
Organism	Caenorhabditis elegans.
Sequence Length	588
Subcellular Localization	Nucleus .
Protein Description	Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex (By similarity)..
Protein Sequence	MTLMIDENFKKQLAQRRERVEDLFYFENSKEIGRGTYGLVYKAVPKKQNGQFPNKEYALKMIEGQGFSMSACREIALFRELRHPNLICLQRVFLTNEKKVWLLLDYAEHDLWHVIKHHRTAKSKKVPIMVPRNMVKNILFQILSGMHYLHSNWVLHRDLKPANILLMGDGPPDMRGRVKIADLGFSRIYANPLKPMAELDPVVVTFWYRAPELLLGAKHYTKAIDVWAIGCIFAELLTAEPLFFCKEEDIKAQNPYHYDQVKRIFHLLGYPSDADWPDMKKMPDHQRLLSDARNEGTPIQTFPNSLHRYFDKWKINSQSSPYRLLVKLLTVDPTKRVSCEEAMNDIYFRKMERPPRETDDVFNKYPIPYAKKEQQMTVAPDQAQQQHQQQQVQMQQQPQMGQQQMMGQPQMVQPQMGQPPMGGAHPGVVAPDGHPHQMMQQQQHPQQHHMQYQGMHDPMQGGMDEGPQAKMMRMGNVPVGRYAPMPPPYGAPQDYHPQQGPPMVQMMQQPGPSGYYPQRPGQPTGAVPGPGPQGYMNPQMGMQMGMRAPGVPPQGYMPGRGMAPPQMGQQQPGPNQQQQQQWQQQYHR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CDK8_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CDK8_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CDK8_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CDK8_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CDK8_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CDK8_CAEEL

Related Literatures of Post-Translational Modification