CDK8_CAEEL - dbPTM
CDK8_CAEEL - PTM Information in dbPTM
Basic Information of Protein
UniProt ID CDK8_CAEEL
UniProt AC P90866
Protein Name Cyclin-dependent kinase 8
Gene Name cdk-8
Organism Caenorhabditis elegans.
Sequence Length 588
Subcellular Localization Nucleus .
Protein Description Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex (By similarity)..
Protein Sequence MTLMIDENFKKQLAQRRERVEDLFYFENSKEIGRGTYGLVYKAVPKKQNGQFPNKEYALKMIEGQGFSMSACREIALFRELRHPNLICLQRVFLTNEKKVWLLLDYAEHDLWHVIKHHRTAKSKKVPIMVPRNMVKNILFQILSGMHYLHSNWVLHRDLKPANILLMGDGPPDMRGRVKIADLGFSRIYANPLKPMAELDPVVVTFWYRAPELLLGAKHYTKAIDVWAIGCIFAELLTAEPLFFCKEEDIKAQNPYHYDQVKRIFHLLGYPSDADWPDMKKMPDHQRLLSDARNEGTPIQTFPNSLHRYFDKWKINSQSSPYRLLVKLLTVDPTKRVSCEEAMNDIYFRKMERPPRETDDVFNKYPIPYAKKEQQMTVAPDQAQQQHQQQQVQMQQQPQMGQQQMMGQPQMVQPQMGQPPMGGAHPGVVAPDGHPHQMMQQQQHPQQHHMQYQGMHDPMQGGMDEGPQAKMMRMGNVPVGRYAPMPPPYGAPQDYHPQQGPPMVQMMQQPGPSGYYPQRPGQPTGAVPGPGPQGYMNPQMGMQMGMRAPGVPPQGYMPGRGMAPPQMGQQQPGPNQQQQQQWQQQYHR
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of CDK8_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of CDK8_CAEEL !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of CDK8_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of CDK8_CAEEL !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of CDK8_CAEEL !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of CDK8_CAEEL

loading...

Related Literatures of Post-Translational Modification

TOP