dbPTM

CDIPT_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CDIPT_MOUSE
UniProt AC	Q8VDP6
Protein Name	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
Gene Name	Cdipt
Organism	Mus musculus (Mouse).
Sequence Length	213
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. Cell membrane Multi-pass membrane protein. Membrane.
Protein Description	Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme (By similarity)..
Protein Sequence	MPEENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFNFSEGPLVGSVGLFRMGLWVTAPIALLKSVISVIHLITAARNMAALDAADRAKKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
121	Ubiquitination	VRGSESHKMIDLSGN HCCCCCCCEEECCCC	46.99	22790023
187	Phosphorylation	APIALLKSVISVIHL HHHHHHHHHHHHHHH	25.34	25367039
190	Phosphorylation	ALLKSVISVIHLITA HHHHHHHHHHHHHHH	16.92	25367039
196	Phosphorylation	ISVIHLITAARNMAA HHHHHHHHHHHHHHH	22.18	25367039

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CDIPT_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CDIPT_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CDIPT_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CDIPT_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CDIPT_MOUSE

Related Literatures of Post-Translational Modification