| UniProt ID | CDIP1_RAT | |
|---|---|---|
| UniProt AC | Q5U2U6 | |
| Protein Name | Cell death-inducing p53-target protein 1 | |
| Gene Name | Cdip1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 208 | |
| Subcellular Localization |
Late endosome membrane Peripheral membrane protein Cytoplasmic side . Lysosome membrane Peripheral membrane protein Cytoplasmic side . |
|
| Protein Description | Acts as an important p53/TP53-apoptotic effector. Regulates TNF-alpha-mediated apoptosis in a p53/TP53-dependent manner.. | |
| Protein Sequence | MSNEPPPPYPGGPTAPLLEEKSGAPHTPGRTSPAVMQPPPGMPLPSADIAPPPYEPPGHPVPQPGFVPPHMNADGTYMPAGFYPPPGPHPPMGYYPPGPYPPGSYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYICTYKRLC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Ubiquitination | TAPLLEEKSGAPHTP CCCCCCCCCCCCCCC | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDIP1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDIP1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDIP1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CDIP1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...