CDIP1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CDIP1_RAT
• UniProt AC: Q5U2U6
• Protein Name: Cell death-inducing p53-target protein 1
• Gene Name: Cdip1
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 208
• Subcellular Localization: Late endosome membrane ; Peripheral membrane protein ; Cytoplasmic side . Lysosome membrane ; Peripheral membrane protein ; Cytoplasmic side .
• Protein Description: Acts as an important p53/TP53-apoptotic effector. Regulates TNF-alpha-mediated apoptosis in a p53/TP53-dependent manner..
• Protein Sequence: MSNEPPPPYPGGPTAPLLEEKSGAPHTPGRTSPAVMQPPPGMPLPSADIAPPPYEPPGHPVPQPGFVPPHMNADGTYMPAGFYPPPGPHPPMGYYPPGPYPPGSYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYICTYKRLC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Ubiquitination	TAPLLEEKSGAPHTP CCCCCCCCCCCCCCC		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CDIP1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CDIP1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CDIP1_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of CDIP1_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.