UniProt ID | CDIP1_HUMAN | |
---|---|---|
UniProt AC | Q9H305 | |
Protein Name | Cell death-inducing p53-target protein 1 | |
Gene Name | CDIP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 208 | |
Subcellular Localization |
Late endosome membrane Peripheral membrane protein Cytoplasmic side . Lysosome membrane Peripheral membrane protein Cytoplasmic side . |
|
Protein Description | Acts as an important p53/TP53-apoptotic effector. Regulates TNF-alpha-mediated apoptosis in a p53/TP53-dependent manner.. | |
Protein Sequence | MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Ubiquitination | TAPLLEEKSGAPPTP CCCCCCCCCCCCCCC | 23000965 | ||
27 | Phosphorylation | EKSGAPPTPGRSSPA CCCCCCCCCCCCCCC | 23312004 | ||
119 | Ubiquitination | TATVLVPSGAATTVT EEEEEEECCCCCEEE | 23000965 | ||
119 | Ubiquitination | TATVLVPSGAATTVT EEEEEEECCCCCEEE | 21890473 | ||
126 | Ubiquitination | SGAATTVTVLQGEIF CCCCCEEEEEECEEC | 23000965 | ||
126 | Ubiquitination | SGAATTVTVLQGEIF CCCCCEEEEEECEEC | 21890473 | ||
159 | Ubiquitination | KISYEIGLMNFVLGF HHHHHHHHHHHHHHH | 23000965 | ||
159 | Ubiquitination | KISYEIGLMNFVLGF HHHHHHHHHHHHHHH | 21890473 | ||
166 | Ubiquitination | LMNFVLGFFCCFMGC HHHHHHHHHHHHHCC | 23000965 | ||
166 | Ubiquitination | LMNFVLGFFCCFMGC HHHHHHHHHHHHHCC | 21890473 | ||
198 | Ubiquitination | THTCPSCKAYIYTYK CCCCHHHCEEEEEEH | 23000965 | ||
204 | Phosphorylation | CKAYIYTYKRLC--- HCEEEEEEHHCC--- | 29496907 | ||
205 | Ubiquitination | KAYIYTYKRLC---- CEEEEEEHHCC---- | 23000965 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDIP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDIP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDIP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CDIP1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...