CD81_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CD81_RAT
• UniProt AC: Q62745
• Protein Name: CD81 antigen
• Gene Name: Cd81
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 236
• Subcellular Localization: Basolateral cell membrane ; Multi-pass membrane protein . Associates with CLDN1 and the CLDN1-CD81 complex localizes to the basolateral cell membrane.
• Protein Description: May play an important role in the regulation of lymphoma cell growth..
• Protein Sequence: MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTTLLYLELGDKPAPSTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNTLTTLTTAVLRNSLCPSSSNSFTQLLKEDCHQKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
121	Acetylation	VNKDQIAKDVKQFYD CCHHHHHHHHHHHHH	65.76	22902405
177	Phosphorylation	LRNSLCPSSSNSFTQ HHCCCCCCCCCHHHH	45.46	27097102
178	Phosphorylation	RNSLCPSSSNSFTQL HCCCCCCCCCHHHHH	20.77	27097102
179	Phosphorylation	NSLCPSSSNSFTQLL CCCCCCCCCHHHHHH	40.61	27097102
181	Phosphorylation	LCPSSSNSFTQLLKE CCCCCCCHHHHHHHH	31.45	27097102
183	Phosphorylation	PSSSNSFTQLLKEDC CCCCCHHHHHHHHHH	20.37	27097102

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CD81_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CD81_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CD81_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of CD81_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.