UniProt ID | CD5R2_HUMAN | |
---|---|---|
UniProt AC | Q13319 | |
Protein Name | Cyclin-dependent kinase 5 activator 2 | |
Gene Name | CDK5R2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 367 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Activator of CDK5/TPKII.. | |
Protein Sequence | MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKHWTMNLDR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | N-myristoyl glycine | ------MGTVLSLSP ------CCCEEECCC | 25.24 | - | |
2 | Myristoylation | ------MGTVLSLSP ------CCCEEECCC | 25.24 | 18507738 | |
3 | O-linked_Glycosylation | -----MGTVLSLSPA -----CCCEEECCCC | 19.58 | 30379171 | |
3 | Phosphorylation | -----MGTVLSLSPA -----CCCEEECCCC | 19.58 | 29083192 | |
6 | Phosphorylation | --MGTVLSLSPASSA --CCCEEECCCCCCC | 23.59 | 29083192 | |
8 | Phosphorylation | MGTVLSLSPASSAKG CCCEEECCCCCCCCC | 18.29 | 29083192 | |
67 | Acetylation | LISALTWKRLVAASA HHHHHHHHHHHHHHH | 30.53 | 7668563 | |
84 | Phosphorylation | KKGSKKVTPKPASTG CCCCCCCCCCCCCCC | 34.18 | 23312004 | |
173 | Phosphorylation | APPVPGGSPRRVIVQ CCCCCCCCCCEEEEE | 22.58 | 28102081 | |
358 | Phosphorylation | RDSCAAGTKHWTMNL HHHHCCCCCCCEECC | 18.27 | 22210691 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD5R2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD5R2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CD5R2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Myristoylation | |
Reference | PubMed |
"Myristoylation of p39 and p35 is a determinant of cytoplasmic ornuclear localization of active cyclin-dependent kinase 5 complexes."; Asada A., Yamamoto N., Gohda M., Saito T., Hayashi N., Hisanaga S.; J. Neurochem. 106:1325-1336(2008). Cited for: SUBCELLULAR LOCATION, MYRISTOYLATION, AND MUTAGENESIS OF GLY-2. |