UniProt ID | CD52_HUMAN | |
---|---|---|
UniProt AC | P31358 | |
Protein Name | CAMPATH-1 antigen | |
Gene Name | CD52 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 61 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
Protein Description | May play a role in carrying and orienting carbohydrate, as well as having a more specific role.. | |
Protein Sequence | MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | N-linked_Glycosylation | QTGLSGQNDTSQTSS HHCCCCCCCCCCCCC | 59.04 | UniProtKB CARBOHYD | |
27 | N-linked_Glycosylation | QTGLSGQNDTSQTSS HHCCCCCCCCCCCCC | 59.04 | 7890742 | |
36 | GPI-anchor | TSQTSSPSASSNISG CCCCCCCCCCCCCCH | 42.61 | 7688956 | |
40 | N-linked_Glycosylation | SSPSASSNISGGIFL CCCCCCCCCCHHHHH | 29.92 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD52_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD52_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD52_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CD52_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
D02802 | Alemtuzumab (genetical recombination) (JAN); Alemtuzumab (USAN/INN); Campath (TN) | |||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
GPI-anchor | |
Reference | PubMed |
"Structure of the CAMPATH-1 antigen, a glycosylphosphatidylinositol-anchored glycoprotein which is an exceptionally good target forcomplement lysis."; Xia M.Q., Hale G., Lifely M.R., Ferguson M.A., Campbell D.,Packman L., Waldmann H.; Biochem. J. 293:633-640(1993). Cited for: GPI-ANCHOR AT SER-36. |