UniProt ID | CD320_HUMAN | |
---|---|---|
UniProt AC | Q9NPF0 | |
Protein Name | CD320 antigen | |
Gene Name | CD320 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 282 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . |
|
Protein Description | Receptor for transcobalamin saturated with cobalamin (TCbl). [PubMed: 18779389 Plays an important role in cobalamin uptake] | |
Protein Sequence | MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | O-linked_Glycosylation | ASPLSTPTSAQAAGP HCCCCCCCCHHHCCC | 36.46 | OGP | |
43 | O-linked_Glycosylation | SPLSTPTSAQAAGPS CCCCCCCCHHHCCCC | 21.42 | OGP | |
50 | O-linked_Glycosylation | SAQAAGPSSGSCPPT CHHHCCCCCCCCCCC | 46.55 | OGP | |
63 | O-linked_Glycosylation | PTKFQCRTSGLCVPL CCCEEECCCCCEEEE | 34.47 | OGP | |
63 | Phosphorylation | PTKFQCRTSGLCVPL CCCEEECCCCCEEEE | 34.47 | 27080861 | |
64 | Phosphorylation | TKFQCRTSGLCVPLT CCEEECCCCCEEEEE | 15.49 | 27080861 | |
71 | Phosphorylation | SGLCVPLTWRCDRDL CCCEEEEEEEECCCC | 12.56 | 27080861 | |
81 | Phosphorylation | CDRDLDCSDGSDEEE ECCCCCCCCCCCHHH | 44.68 | 29759185 | |
84 | Phosphorylation | DLDCSDGSDEEECRI CCCCCCCCCHHHCCE | 47.00 | 28985074 | |
95 | Phosphorylation | ECRIEPCTQKGQCPP HCCEECCCCCCCCCC | 43.99 | - | |
95 | O-linked_Glycosylation | ECRIEPCTQKGQCPP HCCEECCCCCCCCCC | 43.99 | OGP | |
97 | Ubiquitination | RIEPCTQKGQCPPPP CEECCCCCCCCCCCC | 32.56 | - | |
111 | Phosphorylation | PGLPCPCTGVSDCSG CCCCCCCCCCCCCCC | 26.26 | 25627689 | |
111 | O-linked_Glycosylation | PGLPCPCTGVSDCSG CCCCCCCCCCCCCCC | 26.26 | OGP | |
114 | Phosphorylation | PCPCTGVSDCSGGTD CCCCCCCCCCCCCCC | 33.95 | 25627689 | |
117 | Phosphorylation | CTGVSDCSGGTDKKL CCCCCCCCCCCCHHH | 45.29 | 25627689 | |
120 | Phosphorylation | VSDCSGGTDKKLRNC CCCCCCCCCHHHHHH | 48.44 | 25627689 | |
122 | Ubiquitination | DCSGGTDKKLRNCSR CCCCCCCHHHHHHHH | 54.25 | - | |
123 | Ubiquitination | CSGGTDKKLRNCSRL CCCCCCHHHHHHHHH | 56.33 | - | |
126 | N-linked_Glycosylation | GTDKKLRNCSRLACL CCCHHHHHHHHHHHH | 38.25 | UniProtKB CARBOHYD | |
140 | O-linked_Glycosylation | LAGELRCTLSDDCIP HHHHHEEEECCCEEE | 23.90 | OGP | |
179 | O-linked_Glycosylation | ILPEGDATTMGPPVT CCCCCCCCCCCCCEE | 23.27 | OGP | |
180 | O-linked_Glycosylation | LPEGDATTMGPPVTL CCCCCCCCCCCCEEH | 23.11 | OGP | |
186 | O-linked_Glycosylation | TTMGPPVTLESVTSL CCCCCCEEHHHHHHC | 30.49 | OGP | |
195 | N-linked_Glycosylation | ESVTSLRNATTMGPP HHHHHCCCCCCCCCC | 47.10 | UniProtKB CARBOHYD | |
213 | N-linked_Glycosylation | ESVPSVGNATSSSAG ECCCCCCCCCCCCCC | 37.58 | UniProtKB CARBOHYD | |
227 | Ubiquitination | GDQSGSPTAYGVIAA CCCCCCCCHHHHHHH | 33.92 | 23000965 | |
236 | Ubiquitination | YGVIAAAAVLSASLV HHHHHHHHHHHHHHH | 9.69 | 21963094 | |
269 | Ubiquitination | LGLLVAMKESLLLSE HHHHHHHHHHHHHHH | 34.12 | 23000965 | |
275 | Phosphorylation | MKESLLLSEQKTSLP HHHHHHHHHHCCCCC | 37.64 | 21815630 | |
278 | Ubiquitination | SLLLSEQKTSLP--- HHHHHHHCCCCC--- | 35.71 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD320_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD320_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD320_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRDX2_HUMAN | PRDX2 | physical | 21988832 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
613646 | Methylmalonic aciduria type TCblR (MMATC) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...