| UniProt ID | CD20_MOUSE | |
|---|---|---|
| UniProt AC | P19437 | |
| Protein Name | B-lymphocyte antigen CD20 | |
| Gene Name | Ms4a1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 291 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. Cell membrane Lipid-anchor. |
|
| Protein Description | This protein may be involved in the regulation of B-cell activation and proliferation.. | |
| Protein Sequence | MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 27 | Phosphorylation | PKVNLKRTSSLVGPT CCCCCCCCHHCCCCC | 22.53 | 24704852 | |
| 28 | Phosphorylation | KVNLKRTSSLVGPTQ CCCCCCCHHCCCCCH | 26.21 | 24704852 | |
| 29 | Phosphorylation | VNLKRTSSLVGPTQS CCCCCCHHCCCCCHH | 26.85 | 27180971 | |
| 36 | Phosphorylation | SLVGPTQSFFMRESK HCCCCCHHHHHHHHH | 23.95 | 21183079 | |
| 214 | S-palmitoylation | ENEWKRMCTRSKSNV HCHHHHHHCCCCCCE | 3.12 | - | |
| 217 | Phosphorylation | WKRMCTRSKSNVVLL HHHHHCCCCCCEEEE | 23.45 | - | |
| 219 | Phosphorylation | RMCTRSKSNVVLLSA HHHCCCCCCEEEEEC | 35.78 | 19060867 | |
| 225 | Phosphorylation | KSNVVLLSAGEKNEQ CCCEEEEECCCCCCH | 30.02 | 24704852 | |
| 229 | Ubiquitination | VLLSAGEKNEQTIKM EEEECCCCCCHHHCC | 65.94 | - | |
| 233 | Phosphorylation | AGEKNEQTIKMKEEI CCCCCCHHHCCHHHH | 19.18 | 19060867 | |
| 247 | Phosphorylation | IIELSGVSSQPKNEE HHHHHCCCCCCCCHH | 27.12 | 24704852 | |
| 248 | Phosphorylation | IELSGVSSQPKNEEE HHHHCCCCCCCCHHH | 48.36 | 24704852 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD20_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD20_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD20_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CD20_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
