UniProt ID | CD151_HUMAN | |
---|---|---|
UniProt AC | P48509 | |
Protein Name | CD151 antigen | |
Gene Name | CD151 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 253 | |
Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
Protein Description | Essential for the proper assembly of the glomerular and tubular basement membranes in kidney.; (Microbial infection) Plays a role in human papillomavirus 16/HPV-16 endocytosis upon binding to cell surface receptor.. | |
Protein Sequence | MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Ubiquitination | -MGEFNEKKTTCGTV -CCCCCCCCCCHHHH | 57.43 | 18713730 | |
7 | 2-Hydroxyisobutyrylation | -MGEFNEKKTTCGTV -CCCCCCCCCCHHHH | 57.43 | - | |
8 | Ubiquitination | MGEFNEKKTTCGTVC CCCCCCCCCCHHHHH | 42.77 | 8713730 | |
11 | S-palmitoylation | FNEKKTTCGTVCLKY CCCCCCCHHHHHHHH | 5.35 | 11907260 | |
15 | S-palmitoylation | KTTCGTVCLKYLLFT CCCHHHHHHHHHHHH | 2.45 | 11907260 | |
17 | Ubiquitination | TCGTVCLKYLLFTYN CHHHHHHHHHHHHHH | 28.82 | 1871373 | |
48 | Phosphorylation | TLALKSDYISLLASG HHHHCCCHHHHHHHC | 10.25 | - | |
79 | S-palmitoylation | MVTGVLGCCATFKER HHCCCHHHHHCHHHH | 0.94 | 12110679 | |
80 | S-palmitoylation | VTGVLGCCATFKERR HCCCHHHHHCHHHHH | 3.66 | 12110679 | |
132 | Ubiquitination | NLKDTMTKRYHQPGH HHHHHHHHHCCCCCH | 39.89 | - | |
159 | N-linked_Glycosylation | EFHCCGSNNSQDWRD HHCCCCCCCCCCCCC | 37.14 | UniProtKB CARBOHYD | |
167 | Phosphorylation | NSQDWRDSEWIRSQE CCCCCCCCHHHHCHH | 26.68 | 23927012 | |
184 | S-palmitoylation | GRVVPDSCCKTVVAL CCCCCHHHHHHHHHH | 3.44 | 29575903 | |
185 | S-palmitoylation | RVVPDSCCKTVVALC CCCCHHHHHHHHHHH | 4.85 | 29575903 | |
186 | Ubiquitination | VVPDSCCKTVVALCG CCCHHHHHHHHHHHC | 48.99 | - | |
187 | O-linked_Glycosylation | VPDSCCKTVVALCGQ CCHHHHHHHHHHHCC | 13.29 | OGP | |
192 | S-palmitoylation | CKTVVALCGQRDHAS HHHHHHHHCCCCCCC | 2.92 | 29575903 | |
199 | Phosphorylation | CGQRDHASNIYKVEG HCCCCCCCCEEEEEC | 21.97 | 21406692 | |
202 | Phosphorylation | RDHASNIYKVEGGCI CCCCCCEEEEECCHH | 17.15 | 21406692 | |
203 | 2-Hydroxyisobutyrylation | DHASNIYKVEGGCIT CCCCCEEEEECCHHH | 29.97 | - | |
203 | Ubiquitination | DHASNIYKVEGGCIT CCCCCEEEEECCHHH | 29.97 | - | |
211 | Ubiquitination | VEGGCITKLETFIQE EECCHHHHHHHHHHH | 25.14 | - | |
242 | S-palmitoylation | VFGMIFTCCLYRSLK HHHHHHHHHHHHHHC | 0.75 | 11907260 | |
243 | S-palmitoylation | FGMIFTCCLYRSLKL HHHHHHHHHHHHHCC | 3.21 | 11907260 | |
249 | Ubiquitination | CCLYRSLKLEHY--- HHHHHHHCCCCC--- | 53.74 | 21890473 | |
253 | Phosphorylation | RSLKLEHY------- HHHCCCCC------- | 15.75 | 27642862 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD151_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD151_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD151_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MCP_HUMAN | CD46 | physical | 10741407 | |
ITA3_HUMAN | ITGA3 | physical | 10734060 | |
FPRP_HUMAN | PTGFRN | physical | 11278880 | |
ITB1_HUMAN | ITGB1 | physical | 12175627 | |
GRM1C_HUMAN | GRAMD1C | physical | 25416956 |
loading...
Palmitoylation | |
Reference | PubMed |
"Palmitoylation of tetraspanin proteins: modulation of CD151 lateralinteractions, subcellular distribution, and integrin-dependent cellmorphology."; Yang X., Claas C., Kraeft S.K., Chen L.B., Wang Z., Kreidberg J.A.,Hemler M.E.; Mol. Biol. Cell 13:767-781(2002). Cited for: PALMITOYLATION AT CYS-11; CYS-15; CYS-242 AND CYS-243. |