CCR1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCR1_MOUSE
• UniProt AC: P51675
• Protein Name: C-C chemokine receptor type 1
• Gene Name: Ccr1
• Organism: Mus musculus (Mouse).
• Sequence Length: 355
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Description: Receptor for a C-C type chemokine. Binds to MIP-1-alpha, RANTES, and less efficiently, to MIP-1-beta or MCP-1 and subsequently transduces a signal by increasing the intracellular calcium ions level. Responsible for affecting stem cell proliferation..
• Protein Sequence: MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
67	Phosphorylation	MQHRRLQSMTSIYLF HHHHHHHHCHHHHHH	28.72	26160508
69	Phosphorylation	HRRLQSMTSIYLFNL HHHHHHCHHHHHHHH	19.74	26160508
70	Phosphorylation	RRLQSMTSIYLFNLA HHHHHCHHHHHHHHH	10.70	26160508
72	Phosphorylation	LQSMTSIYLFNLAVS HHHCHHHHHHHHHHH	12.66	26160508
132	Phosphorylation	ILLTIDRYLAIVHAV HHHHHHHHHHHHHHH	9.20	-
339	Phosphorylation	SVDQLERTSSISPST CHHHHHHCCCCCCCC	19.90	29472430
340	Phosphorylation	VDQLERTSSISPSTG HHHHHHCCCCCCCCC	31.71	26026062
341	Phosphorylation	DQLERTSSISPSTGE HHHHHCCCCCCCCCC	26.86	27180971
343	Phosphorylation	LERTSSISPSTGEHE HHHCCCCCCCCCCCC	18.10	26026062
345	Phosphorylation	RTSSISPSTGEHELS HCCCCCCCCCCCCCC	42.10	22817900
346	Phosphorylation	TSSISPSTGEHELSA CCCCCCCCCCCCCCC	50.39	30635358
352	Phosphorylation	STGEHELSAGF---- CCCCCCCCCCC----	24.30	27742792

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCR1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCR1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCR1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CCR1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.