CCNE1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCNE1_MOUSE
• UniProt AC: Q61457
• Protein Name: G1/S-specific cyclin-E1
• Gene Name: Ccne1
• Organism: Mus musculus (Mouse).
• Sequence Length: 408
• Subcellular Localization: Nucleus.
• Protein Description: Essential for the control of the cell cycle at the G1/S (start) transition..
• Protein Sequence: MPRERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQPWDDNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQTHTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MPRERDSTDHSNMK -CCCCCCCCCCCCCC	41.79	25338131
11	Phosphorylation	ERDSTDHSNMKEEGG CCCCCCCCCCCCCCC	41.24	25266776
70	Phosphorylation	SACVDPCSFIPTPNK CCCCCCCCCCCCCCC	31.44	25619855
74	Phosphorylation	DPCSFIPTPNKEEDN CCCCCCCCCCCCCCC	34.38	25619855
85	Phosphorylation	EEDNELEYPRTAFQP CCCCCCCCCCCCCCC	15.61	25619855
101	Phosphorylation	KIRPPRASPLPVLNW CCCCCCCCCCCCCCC	28.40	19060867
379	Phosphorylation	QAKKAILSEQNRISP HHHHHHHCCCCCCCC	30.90	25619855
385	Phosphorylation	LSEQNRISPPPSVVL HCCCCCCCCCCCEEE	28.28	26824392
389	Phosphorylation	NRISPPPSVVLTPPP CCCCCCCCEEECCCC	30.54	25619855
393	Phosphorylation	PPPSVVLTPPPSSKK CCCCEEECCCCCCCC	23.34	18559482
397	Phosphorylation	VVLTPPPSSKKQSSE EEECCCCCCCCCCCC	61.64	25619855
398	Phosphorylation	VLTPPPSSKKQSSEQ EECCCCCCCCCCCCC	50.04	25619855

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Fbxw7	Q8VBV4	PMID:22199232
-	K	Ubiquitination	E3 ubiquitin ligase	Skp2	Q9Z0Z3	PMID:22199232

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
74	T	Phosphorylation	Phosphorylation at Thr-74 creates a low affinity degron also recognized by FBXW7 (By similarity).	-
393	T	Phosphorylation	Phosphorylation of both Thr-393 by GSK3 and Ser-397 by CDK2 creates a high affinity degron recognized by FBXW7, and accelerates degradation via the ubiquitin proteasome pathway.	-
393	T	ubiquitylation	Phosphorylation of both Thr-393 by GSK3 and Ser-397 by CDK2 creates a high affinity degron recognized by FBXW7, and accelerates degradation via the ubiquitin proteasome pathway.	-
397	S	Phosphorylation	Phosphorylation of both Thr-393 by GSK3 and Ser-397 by CDK2 creates a high affinity degron recognized by FBXW7, and accelerates degradation via the ubiquitin proteasome pathway.	-
397	S	ubiquitylation	Phosphorylation of both Thr-393 by GSK3 and Ser-397 by CDK2 creates a high affinity degron recognized by FBXW7, and accelerates degradation via the ubiquitin proteasome pathway.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCNE1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDK2_MOUSE	Cdk2	physical	16102793
CDK2_MOUSE	Cdk2	physical	8226784
CDK2_MOUSE	Cdk2	physical	14627988
CDK2_MOUSE	Cdk2	physical	8769642
CDK2_MOUSE	Cdk2	physical	17699765
CDK2_MOUSE	Cdk2	physical	15155733
CDK2_MOUSE	Cdk2	physical	18635963
CDK2_MOUSE	Cdk2	physical	16627785

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.