CCND3_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCND3_RAT
• UniProt AC: P48961
• Protein Name: G1/S-specific cyclin-D3
• Gene Name: Ccnd3
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 293
• Subcellular Localization: Nucleus. Cytoplasm. Membrane. Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated to the nucleus through interaction with KIP/CIP family members..
• Protein Description: Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex..
• Protein Sequence: MELLCCEGTRLAPRAGPDPRLLGDQRVLQSLLRLEERYVPRGSYFQCVQKEIKPHMRKMLAYWMLEVCEEQRCEEDVFPLAMNYLDRYLSCVPTRKAQLQLLGTVCLLLASKLRETTPLTIEKLCIYTDQAMAPWQLREWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPSDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVLGLGACSMSADELTELLAGITGTEVDCLRACQEQQIEAALRESLREAAQTAPSPVPKAPGGSSSQGPSQTSTPTDVTAIHL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
30	Phosphorylation	GDQRVLQSLLRLEER CCHHHHHHHHHHHHH	25.80	22673903
262	Phosphorylation	SLREAAQTAPSPVPK HHHHHHHHCCCCCCC	35.49	27097102
265	Phosphorylation	EAAQTAPSPVPKAPG HHHHHCCCCCCCCCC	35.74	27097102
274	Phosphorylation	VPKAPGGSSSQGPSQ CCCCCCCCCCCCCCC	32.50	22673903
275	Phosphorylation	PKAPGGSSSQGPSQT CCCCCCCCCCCCCCC	29.92	22673903
276	Phosphorylation	KAPGGSSSQGPSQTS CCCCCCCCCCCCCCC	40.63	22673903
280	Phosphorylation	GSSSQGPSQTSTPTD CCCCCCCCCCCCCCC	53.57	22673903
282	Phosphorylation	SSQGPSQTSTPTDVT CCCCCCCCCCCCCCE	38.62	22673903
283	Phosphorylation	SQGPSQTSTPTDVTA CCCCCCCCCCCCCEE	25.42	22673903
284	Phosphorylation	QGPSQTSTPTDVTAI CCCCCCCCCCCCEEE	33.33	22673903
286	Phosphorylation	PSQTSTPTDVTAIHL CCCCCCCCCCEEECC	43.09	22673903
289	Phosphorylation	TSTPTDVTAIHL--- CCCCCCCEEECC---	23.78	22673903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCND3_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCND3_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCND3_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of CCND3_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.