| UniProt ID | CCD50_RAT | |
|---|---|---|
| UniProt AC | Q810U0 | |
| Protein Name | Coiled-coil domain-containing protein 50 | |
| Gene Name | Ccdc50 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 305 | |
| Subcellular Localization | ||
| Protein Description | Involved in EGFR signaling.. | |
| Protein Sequence | MADVSVDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNIQRNRLVQHDLQVAKQLQEEDLKAQAQLQKRYKALEQHDCEIAQEIQEKLTIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHTPEFSGGSASGDNYYYEDGGMKSRGINEAVSAPARVSHRDQEWYDAEIARKLQEEELLATHMDIRAAQVAQDEEIARLLMAEEKKAYKKAKDREKSSLDKRKHDYDCKSKAKSAHSKSKEGDETQRAKIDRPSRPPPPAAMAPEDVDPTHFTNQHSNTRHFSKSESSHKGFHNKQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MADVSVDQS ------CCCCCCCHH | 26.38 | - | |
| 5 | Phosphorylation | ---MADVSVDQSKLP ---CCCCCCCHHHCC | 22.11 | - | |
| 68 | Ubiquitination | QLQEEDLKAQAQLQK HHCHHHHHHHHHHHH | 51.26 | - | |
| 161 | Phosphorylation | RGINEAVSAPARVSH CCCCCCCCCCCCCCC | 35.27 | 22108457 | |
| 181 | Ubiquitination | YDAEIARKLQEEELL HHHHHHHHHCHHHHH | 45.56 | - | |
| 279 | Phosphorylation | APEDVDPTHFTNQHS CCCCCCCCCCCCCCC | 25.76 | 27097102 | |
| 282 | Phosphorylation | DVDPTHFTNQHSNTR CCCCCCCCCCCCCCC | 26.77 | 27097102 | |
| 286 | Phosphorylation | THFTNQHSNTRHFSK CCCCCCCCCCCCCCC | 30.08 | 27097102 | |
| 288 | Phosphorylation | FTNQHSNTRHFSKSE CCCCCCCCCCCCCCC | 28.65 | 27097102 | |
| 292 | Phosphorylation | HSNTRHFSKSESSHK CCCCCCCCCCCCCCC | 29.19 | 25575281 | |
| 294 | Phosphorylation | NTRHFSKSESSHKGF CCCCCCCCCCCCCCC | 41.32 | 25575281 | |
| 296 | Phosphorylation | RHFSKSESSHKGFHN CCCCCCCCCCCCCCC | 44.85 | 25575281 | |
| 297 | Phosphorylation | HFSKSESSHKGFHNK CCCCCCCCCCCCCCC | 25.76 | 25575281 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCD50_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCD50_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCD50_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CCD50_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
