| UniProt ID | CC134_HUMAN | |
|---|---|---|
| UniProt AC | Q9H6E4 | |
| Protein Name | Coiled-coil domain-containing protein 134 | |
| Gene Name | CCDC134 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 229 | |
| Subcellular Localization | Nucleus . Cytoplasm . Secreted . Endoplasmic reticulum . Accumulates in the nucleus in response to UV irradiation (PubMed:22644376). | |
| Protein Description | In extracellular secreted form, promotes proliferation and activation of CD8(+) T cells, suggesting a cytokine-like function. [PubMed: 25125657 Enhances cytotoxic anti-tumor activity of CD8(+) T cells] | |
| Protein Sequence | MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | Phosphorylation | GATGTLRTSLDPSLE CCCCHHHCCCCCCHH | 36.43 | 20639409 | |
| 27 | Phosphorylation | ATGTLRTSLDPSLEI CCCHHHCCCCCCHHH | 25.09 | 20639409 | |
| 31 | Phosphorylation | LRTSLDPSLEIYKKM HHCCCCCCHHHHHHH | 38.00 | 20639409 | |
| 35 | Phosphorylation | LDPSLEIYKKMFEVK CCCCHHHHHHHHHHH | 8.65 | - | |
| 37 | Ubiquitination | PSLEIYKKMFEVKRR CCHHHHHHHHHHHHH | 31.67 | - | |
| 51 | Ubiquitination | REQLLALKNLAQLND HHHHHHHHHHHHHCH | 44.29 | 21890473 | |
| 75 | Ubiquitination | VMLKGLFKVLEDSRT HHHHHHHHHHHCCCC | 51.45 | - | |
| 100 | Ubiquitination | GPFPQDEKLKDAFSH CCCCCCHHHHHHHHH | 69.95 | - | |
| 183 | Ubiquitination | SNFQNPFKIDRTEFI CCCCCCCCCCCCCCC | 44.98 | - | |
| 187 | Phosphorylation | NPFKIDRTEFIPSTD CCCCCCCCCCCCCCC | 31.34 | 20068231 | |
| 187 | O-linked_Glycosylation | NPFKIDRTEFIPSTD CCCCCCCCCCCCCCC | 31.34 | 55825589 | |
| 192 | O-linked_Glycosylation | DRTEFIPSTDPFQKA CCCCCCCCCCHHHHH | 40.40 | 55825595 | |
| 192 | Phosphorylation | DRTEFIPSTDPFQKA CCCCCCCCCCHHHHH | 40.40 | 20068231 | |
| 193 | Phosphorylation | RTEFIPSTDPFQKAL CCCCCCCCCHHHHHH | 42.19 | 20068231 | |
| 193 | O-linked_Glycosylation | RTEFIPSTDPFQKAL CCCCCCCCCHHHHHH | 42.19 | 55825601 | |
| 223 | Phosphorylation | IRKGPRISRSQSEL- HHCCCCCCCCCCCC- | 27.45 | 25159151 | |
| 225 | Phosphorylation | KGPRISRSQSEL--- CCCCCCCCCCCC--- | 31.13 | 22210691 | |
| 227 | Phosphorylation | PRISRSQSEL----- CCCCCCCCCC----- | 41.95 | 23911959 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC134_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC134_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC134_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CC134_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
