UniProt ID | CC124_MOUSE | |
---|---|---|
UniProt AC | Q9D8X2 | |
Protein Name | Coiled-coil domain-containing protein 124 | |
Gene Name | Ccdc124 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 217 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Midbody. Colocalizes with gamma-tubulin at interphase, prophase, metaphase, and anaphase. Relocates from centrosome to midbody at telophase (By similarity).. | |
Protein Description | Required for proper progression of late cytokinetic stages.. | |
Protein Sequence | MPKKFQGENSKSAAARARRAEAKAAADAKKQKELEDAYWKDEDKHVMRKEQRKEEKEKRRLEQLERKKETQRLLEEEDSRLKGGKAPRVAPAKVTRAQIEDSLRREQRAEPVEKAKSHLELPLEENLNRRLQEEGSVEARTVEDAIAVLSVAEEADRHPERRMRAAFTAFEEVQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRALPFNAPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Acetylation | -----MPKKFQGENS -----CCCCCCCCCH | 65.99 | 15612709 | |
38 | Phosphorylation | QKELEDAYWKDEDKH HHHHHHHHCCHHHHH | 25.88 | 22817900 | |
102 | Phosphorylation | TRAQIEDSLRREQRA CHHHHHHHHHHHHHC | 15.81 | 26824392 | |
117 | Phosphorylation | EPVEKAKSHLELPLE CCHHHHHHHHCCCHH | 37.86 | 27180971 | |
136 | Phosphorylation | RRLQEEGSVEARTVE HHHHHHCCCCEECHH | 21.77 | 26824392 | |
168 | Phosphorylation | RRMRAAFTAFEEVQL HHHHHHHHHHHHCCH | 26.22 | 24719451 | |
188 | Phosphorylation | ENPNMRLSQLKQLLK CCCCCCHHHHHHHHH | 24.09 | 29176673 | |
191 | Ubiquitination | NMRLSQLKQLLKKEW CCCHHHHHHHHHHHH | 31.12 | 22790023 | |
201 | Phosphorylation | LKKEWLRSPDNPMNQ HHHHHHCCCCCCCCC | 34.14 | 28066266 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC124_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC124_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC124_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CC124_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...