| UniProt ID | CC124_MOUSE | |
|---|---|---|
| UniProt AC | Q9D8X2 | |
| Protein Name | Coiled-coil domain-containing protein 124 | |
| Gene Name | Ccdc124 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 217 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Midbody. Colocalizes with gamma-tubulin at interphase, prophase, metaphase, and anaphase. Relocates from centrosome to midbody at telophase (By similarity).. | |
| Protein Description | Required for proper progression of late cytokinetic stages.. | |
| Protein Sequence | MPKKFQGENSKSAAARARRAEAKAAADAKKQKELEDAYWKDEDKHVMRKEQRKEEKEKRRLEQLERKKETQRLLEEEDSRLKGGKAPRVAPAKVTRAQIEDSLRREQRAEPVEKAKSHLELPLEENLNRRLQEEGSVEARTVEDAIAVLSVAEEADRHPERRMRAAFTAFEEVQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRALPFNAPK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Acetylation | -----MPKKFQGENS -----CCCCCCCCCH | 65.99 | 15612709 | |
| 38 | Phosphorylation | QKELEDAYWKDEDKH HHHHHHHHCCHHHHH | 25.88 | 22817900 | |
| 102 | Phosphorylation | TRAQIEDSLRREQRA CHHHHHHHHHHHHHC | 15.81 | 26824392 | |
| 117 | Phosphorylation | EPVEKAKSHLELPLE CCHHHHHHHHCCCHH | 37.86 | 27180971 | |
| 136 | Phosphorylation | RRLQEEGSVEARTVE HHHHHHCCCCEECHH | 21.77 | 26824392 | |
| 168 | Phosphorylation | RRMRAAFTAFEEVQL HHHHHHHHHHHHCCH | 26.22 | 24719451 | |
| 188 | Phosphorylation | ENPNMRLSQLKQLLK CCCCCCHHHHHHHHH | 24.09 | 29176673 | |
| 191 | Ubiquitination | NMRLSQLKQLLKKEW CCCHHHHHHHHHHHH | 31.12 | 22790023 | |
| 201 | Phosphorylation | LKKEWLRSPDNPMNQ HHHHHHCCCCCCCCC | 34.14 | 28066266 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC124_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC124_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC124_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CC124_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
