CBY1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CBY1_MOUSE
• UniProt AC: Q9D1C2
• Protein Name: Protein chibby homolog 1
• Gene Name: Cby1
• Organism: Mus musculus (Mouse).
• Sequence Length: 127
• Subcellular Localization: Nucleus speckle . Cytoplasm, cytoskeleton, cilium basal body . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole . Golgi apparatus . Golgi apparatus, trans-Golgi network .
• Protein Description: Inhibits the Wnt/Wingless pathway by binding to CTNNB1/beta-catenin and inhibiting beta-catenin-mediated transcriptional activation through competition with TCF/LEF transcription factors. Has also been shown to play a role in regulating the intracellular trafficking of polycystin-2/PKD2 and possibly of other intracellular proteins. Promotes adipocyte and cardiomyocyte differentiation..
• Protein Sequence: MPLFGSIFSPKKTPPRKSASLSNLHSLDRSTRELELGLDYGTPTMNLAGQSLKFENGQWVADSVISGGVDRRETQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAESHLKDKELDELKVTNRRRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MPLFGSIFSPKKT --CCCCCCCCCCCCC	17.08	29233185
9	Phosphorylation	PLFGSIFSPKKTPPR CCCCCCCCCCCCCCC	33.85	26824392
13	Phosphorylation	SIFSPKKTPPRKSAS CCCCCCCCCCCCCCC	44.65	21082442
18	Phosphorylation	KKTPPRKSASLSNLH CCCCCCCCCCCCCHH	25.11	25168779
20	Phosphorylation	TPPRKSASLSNLHSL CCCCCCCCCCCHHHC	39.15	26824392
22	Phosphorylation	PRKSASLSNLHSLDR CCCCCCCCCHHHCCC	34.55	25619855
26	Phosphorylation	ASLSNLHSLDRSTRE CCCCCHHHCCCCCCH	34.82	26824392
30	Phosphorylation	NLHSLDRSTRELELG CHHHCCCCCCHHHCC	31.33	26643407
31	Phosphorylation	LHSLDRSTRELELGL HHHCCCCCCHHHCCC	29.11	26643407
40	Phosphorylation	ELELGLDYGTPTMNL HHHCCCCCCCCCCCC	28.13	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CBY1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CBY1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CBY1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CBY1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.