UniProt ID | CATW_MOUSE | |
---|---|---|
UniProt AC | P56203 | |
Protein Name | Cathepsin W | |
Gene Name | Ctsw | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 371 | |
Subcellular Localization | ||
Protein Description | May have a specific function in the mechanism or regulation of T-cell cytolytic activity.. | |
Protein Sequence | MTLTAHLSYFLVLLLAGQGLSDSLLTKDAGPRPLELKEVFKLFQIRFNRSYWNPAEYTRRLSIFAHNLAQAQRLQQEDLGTAEFGETPFSDLTEEEFGQLYGQERSPERTPNMTKKVESNTWGESVPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | N-linked_Glycosylation | KLFQIRFNRSYWNPA HHHCCCCCCHHCCHH | 23.34 | - | |
112 | N-linked_Glycosylation | RSPERTPNMTKKVES CCCCCCCCCCCCCCC | 50.58 | - | |
203 | N-linked_Glycosylation | DAYLTVLNNSGLASE HEEEEEECCCCCCCC | 35.96 | - | |
307 | Phosphorylation | KEGMQTGTVLSHSRK CCCCCCCCCEECCCC | 22.97 | 28059163 | |
310 | Phosphorylation | MQTGTVLSHSRKRRH CCCCCCEECCCCCCC | 18.32 | 28059163 | |
344 | N-linked_Glycosylation | YFRLYRGNNTCGVTK CEEEECCCCCCCCEE | 31.47 | - | |
352 | Phosphorylation | NTCGVTKYPFTAQVD CCCCCEECCCEEECC | 8.33 | 28576409 | |
368 | Phosphorylation | PVKKARTSCPP---- CCCHHHCCCCC---- | 21.05 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CATW_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CATW_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CATW_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CATW_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...