UniProt ID | CATL1_RAT | |
---|---|---|
UniProt AC | P07154 | |
Protein Name | Cathepsin L1 | |
Gene Name | Ctsl | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 334 | |
Subcellular Localization |
Lysosome . Procathepsin L: Secreted. |
|
Protein Description | Important for the overall degradation of proteins in lysosomes. Procathepsin L is required for maximal stimulation of steroidogenesis by TIMP1.. | |
Protein Sequence | MTPLLLLAVLCLGTALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQLHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQIPKTVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKNSWGKEWGMDGYIKIAKDRNNHCGLATAASYPIVN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTPLLLLAV ------CCHHHHHHH | 23.73 | 27097102 | |
14 | Phosphorylation | LAVLCLGTALATPKF HHHHHHHHHHCCCCC | 12.92 | 27097102 | |
18 | Phosphorylation | CLGTALATPKFDQTF HHHHHHCCCCCCCCH | 28.06 | 27097102 | |
221 | N-linked_Glycosylation | RAEYAVANDTGFVDI EEEEEECCCCCCCCC | 40.55 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CATL1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CATL1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CATL1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CATL1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...