CATL1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CATL1_RAT
• UniProt AC: P07154
• Protein Name: Cathepsin L1
• Gene Name: Ctsl
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 334
• Subcellular Localization: Lysosome .; Procathepsin L: Secreted.
• Protein Description: Important for the overall degradation of proteins in lysosomes. Procathepsin L is required for maximal stimulation of steroidogenesis by TIMP1..
• Protein Sequence: MTPLLLLAVLCLGTALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQLHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQIPKTVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKNSWGKEWGMDGYIKIAKDRNNHCGLATAASYPIVN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTPLLLLAV ------CCHHHHHHH	23.73	27097102
14	Phosphorylation	LAVLCLGTALATPKF HHHHHHHHHHCCCCC	12.92	27097102
18	Phosphorylation	CLGTALATPKFDQTF HHHHHHCCCCCCCCH	28.06	27097102
221	N-linked_Glycosylation	RAEYAVANDTGFVDI EEEEEECCCCCCCCC	40.55	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CATL1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CATL1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CATL1_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of CATL1_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.