UniProt ID | CAPZB_RAT | |
---|---|---|
UniProt AC | Q5XI32 | |
Protein Name | F-actin-capping protein subunit beta | |
Gene Name | Capzb | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 272 | |
Subcellular Localization | Cytoplasm, cytoskeleton . Cytoplasm, myofibril, sarcomere. | |
Protein Description | F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization (By similarity).. | |
Protein Sequence | MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSDQQLDCA ------CCHHHHHHH | 44.09 | - | |
2 | Phosphorylation | ------MSDQQLDCA ------CCHHHHHHH | 44.09 | 27097102 | |
78 | Acetylation | YRSPWSNKYDPPLED CCCCCCCCCCCCCCC | 45.58 | 22902405 | |
95 | Acetylation | MPSARLRKLEVEANN CCCHHHHHHHHHHCC | 54.30 | 22902405 | |
182 | Phosphorylation | LWLQTNKSGSGTMNL EEEEECCCCCCEEEC | 40.02 | 23984901 | |
184 | Phosphorylation | LQTNKSGSGTMNLGG EEECCCCCCEEECCC | 37.88 | 23984901 | |
186 | Phosphorylation | TNKSGSGTMNLGGSL ECCCCCCEEECCCCC | 12.46 | 23984901 | |
199 | Acetylation | SLTRQMEKDETVSDC CCCHHHHCCCCHHHC | 56.36 | 83036239 | |
204 | Phosphorylation | MEKDETVSDCSPHIA HHCCCCHHHCCHHHH | 40.08 | - | |
223 | Acetylation | LVEDMENKIRSTLNE HHHHHHHHHHHHHHH | 26.62 | 22902405 | |
235 | Acetylation | LNEIYFGKTKDIVNG HHHHHCCCHHHHHHH | 42.37 | 22902405 | |
235 | Ubiquitination | LNEIYFGKTKDIVNG HHHHHCCCHHHHHHH | 42.37 | - | |
252 | Acetylation | SVQTFADKSKQEALK HHHHHCCHHHHHHHH | 57.00 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAPZB_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAPZB_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAPZB_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CAPZB_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...