| UniProt ID | CAMP_HUMAN | |
|---|---|---|
| UniProt AC | P49913 | |
| Protein Name | Cathelicidin antimicrobial peptide {ECO:0000312|HGNC:HGNC:1472} | |
| Gene Name | CAMP {ECO:0000312|HGNC:HGNC:1472} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 170 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.. | |
| Protein Sequence | MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | KTQRDGHSLGRWSLV CCCCCCCHHHHHHHH | 37.74 | 24719451 | |
| 50 | Phosphorylation | IDGINQRSSDANLYR HCCCCCCCCCCCHHH | 23.86 | - | |
| 51 | Phosphorylation | DGINQRSSDANLYRL CCCCCCCCCCCHHHH | 42.82 | - | |
| 66 | O-linked_Glycosylation | LDLDPRPTMDGDPDT HCCCCCCCCCCCCCC | 29.22 | OGP |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAMP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAMP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAMP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MK08_HUMAN | MAPK8 | physical | 21988832 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...