UniProt ID | CAMP_HUMAN | |
---|---|---|
UniProt AC | P49913 | |
Protein Name | Cathelicidin antimicrobial peptide {ECO:0000312|HGNC:HGNC:1472} | |
Gene Name | CAMP {ECO:0000312|HGNC:HGNC:1472} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 170 | |
Subcellular Localization | Secreted. | |
Protein Description | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.. | |
Protein Sequence | MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | KTQRDGHSLGRWSLV CCCCCCCHHHHHHHH | 37.74 | 24719451 | |
50 | Phosphorylation | IDGINQRSSDANLYR HCCCCCCCCCCCHHH | 23.86 | - | |
51 | Phosphorylation | DGINQRSSDANLYRL CCCCCCCCCCCHHHH | 42.82 | - | |
66 | O-linked_Glycosylation | LDLDPRPTMDGDPDT HCCCCCCCCCCCCCC | 29.22 | OGP |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAMP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAMP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAMP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MK08_HUMAN | MAPK8 | physical | 21988832 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...