UniProt ID | CALX1_ARATH | |
---|---|---|
UniProt AC | P29402 | |
Protein Name | Calnexin homolog 1 | |
Gene Name | CNX1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 530 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein. |
|
Protein Description | Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins (By similarity).. | |
Protein Sequence | MRQRQLFSVFLLLLAFVSFQKLCYCDDQTVLYESFDEPFDGRWIVSKNSDYEGVWKHAKSEGHEDYGLLVSEKARKYGIVKELDEPLNLKEGTVVLQYEVRFQEGLECGGAYLKYLRPQEAGWTPQGFDSESPYSIMFGPDKCGGTNKVHFILKHKNPKSGEYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILVDGEEKKKANLLSGEDFEPALIPAKTIPDPEDKKPEDWDERAKIPDPNAVKPEDWDEDAPMEIEDEEAEKPEGWLDDEPEEVDDPEATKPEDWDDEEDGMWEAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWSSPLIDNPAYKGIWKPRDIPNPDYFELDRPDYEPIAAIGIEIWTMQDGILFDNILIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGSADGLKSYQKVVFDLLNKVADLSFLSAYKSKITELIEKAEQQPNLTIGVLVAIVVVFFSLFLKLIFGGKKAAAPVEKKKPEVAESSKSGDEAEKKEETAAPRKRQPRRDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
108 | S-nitrosylation | RFQEGLECGGAYLKY ECCCCCEECCEEEEE | 7.98 | 22115780 | |
464 | N-linked_Glycosylation | EKAEQQPNLTIGVLV HHHHHCCCCHHHHHH | 45.54 | - | |
505 | Phosphorylation | KKPEVAESSKSGDEA CCHHHHHHCCCCCHH | 33.07 | 23776212 | |
506 | Phosphorylation | KPEVAESSKSGDEAE CHHHHHHCCCCCHHH | 23.50 | 23776212 | |
508 | Phosphorylation | EVAESSKSGDEAEKK HHHHHCCCCCHHHHH | 54.12 | 30291188 | |
518 | Phosphorylation | EAEKKEETAAPRKRQ HHHHHHHCCCCCCCC | 29.25 | 19376835 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CALX1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CALX1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CALX1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CALX1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-508, AND MASSSPECTROMETRY. |