CALB2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CALB2_MOUSE
• UniProt AC: Q08331
• Protein Name: Calretinin
• Gene Name: Calb2
• Organism: Mus musculus (Mouse).
• Sequence Length: 271
• Protein Description: Calretinin is a calcium-binding protein which is abundant in auditory neurons..
• Protein Sequence: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDGSGYIDENELDALLKDLYEKNKKEMNIQQLTTYRKSVMSLAEAGKLYRKDLEIVLCSEPPV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
142	Ubiquitination	FLSDLLKKANRPYDE HHHHHHHHCCCCCCC	51.36	27667366
189	Ubiquitination	VQENFLLKFQGMKLT CCCCCHHHHCCCCCC	37.48	22790023
197	Phosphorylation	FQGMKLTSEEFNAIF HCCCCCCHHHHCCEE	45.63	29899451
212	Phosphorylation	TFYDKDGSGYIDENE EEECCCCCCCCCHHH	38.26	24925903
214	Phosphorylation	YDKDGSGYIDENELD ECCCCCCCCCHHHHH	13.59	24925903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CALB2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CALB2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CALB2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CALB2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.