| UniProt ID | CALB2_HUMAN | |
|---|---|---|
| UniProt AC | P22676 | |
| Protein Name | Calretinin | |
| Gene Name | CALB2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 271 | |
| Subcellular Localization | ||
| Protein Description | Calretinin is a calcium-binding protein which is abundant in auditory neurons.. | |
| Protein Sequence | MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Phosphorylation | FDADGNGYIEGKELE CCCCCCCCCCCHHHH | 10.37 | 22817900 | |
| 59 | Phosphorylation | RKGSGMMSKSDNFGE HCCCCCCCCCCCHHH | 21.81 | - | |
| 108 | Phosphorylation | CFRQHVGSSAEFMEA HHHHHCCCHHHHHHH | 25.86 | - | |
| 124 | Phosphorylation | RKYDTDRSGYIEANE HHHCCCCCCCEEHHH | 38.46 | - | |
| 126 | Phosphorylation | YDTDRSGYIEANELK HCCCCCCCEEHHHHH | 9.24 | 22817900 | |
| 137 | Phosphorylation | NELKGFLSDLLKKAN HHHHHHHHHHHHHCC | 24.77 | - | |
| 212 | Phosphorylation | TFYDKDRSGYIDEHE EEECCCCCCCCCHHH | 46.19 | - | |
| 214 | Phosphorylation | YDKDRSGYIDEHELD ECCCCCCCCCHHHHH | 13.37 | 22817900 | |
| 241 | Phosphorylation | EMNIQQLTNYRKSVM HCCHHHHHHHHHHHH | 26.35 | 24043423 | |
| 243 | Phosphorylation | NIQQLTNYRKSVMSL CHHHHHHHHHHHHHH | 17.74 | 24043423 | |
| 246 | Phosphorylation | QLTNYRKSVMSLAEA HHHHHHHHHHHHHHH | 17.66 | 21406692 | |
| 249 | Phosphorylation | NYRKSVMSLAEAGKL HHHHHHHHHHHHHHH | 23.44 | 21406692 | |
| 255 | Acetylation | MSLAEAGKLYRKDLE HHHHHHHHHHHCCCE | 49.76 | 22424773 | |
| 257 | Phosphorylation | LAEAGKLYRKDLEIV HHHHHHHHHCCCEEE | 21.07 | - | |
| 267 | Phosphorylation | DLEIVLCSEPPM--- CCEEEEECCCCC--- | 49.31 | 21964256 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CALB2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CALB2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CALB2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CALB2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
