UniProt ID | CAH5B_HUMAN | |
---|---|---|
UniProt AC | Q9Y2D0 | |
Protein Name | Carbonic anhydrase 5B, mitochondrial | |
Gene Name | CA5B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 317 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | Reversible hydration of carbon dioxide.. | |
Protein Sequence | MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MVVMNSLRVILQA --CCCCCCCEEHHHC | 10.23 | 24247654 | |
54 | Phosphorylation | ALHPLWESVDLVPGG CCCCCCEEEEECCCC | 14.89 | 25002506 | |
116 | Ubiquitination | STDKSVIKGGPLEHN CCCCCCEECCCCCCC | 56.51 | - | |
202 | Phosphorylation | KLVDTLPSIKHKDAL HHHHHCHHHCCCHHE | 47.59 | 24719451 | |
249 | Ubiquitination | SVTWIIKKQPVEVDH CEEEEEECCCCCCCH | 49.80 | - | |
249 | Malonylation | SVTWIIKKQPVEVDH CEEEEEECCCCCCCH | 49.80 | 26320211 | |
249 | Succinylation | SVTWIIKKQPVEVDH CEEEEEECCCCCCCH | 49.80 | 27452117 | |
273 | Ubiquitination | LFTSEGEKEKRMVDN HHCCCCHHHHHHHCC | 78.41 | - | |
295 | Phosphorylation | MNRTVRSSFRHDYVL CCHHHHHHCCCCEEE | 18.74 | 17081983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAH5B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAH5B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAH5B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ODB2_HUMAN | DBT | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...