UniProt ID | CAH1_RAT | |
---|---|---|
UniProt AC | B0BNN3 | |
Protein Name | Carbonic anhydrase 1 {ECO:0000250|UniProtKB:P00915} | |
Gene Name | Ca1 {ECO:0000250|UniProtKB:P00915} | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 261 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Reversible hydration of carbon dioxide.. | |
Protein Sequence | MASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASADWGYD ------CCCCCCCCC | 17.27 | - | |
40 | Acetylation | DIKTSEAKHDSSLKP CCCCCCCCCCCCCCC | 43.84 | 22902405 | |
46 | Acetylation | AKHDSSLKPVSVSYN CCCCCCCCCEEEEEC | 45.37 | 22902405 | |
49 | Phosphorylation | DSSLKPVSVSYNPAT CCCCCCEEEEECCCC | 17.55 | 22276854 | |
51 | Phosphorylation | SLKPVSVSYNPATAK CCCCEEEEECCCCHH | 16.22 | 22276854 | |
52 | Phosphorylation | LKPVSVSYNPATAKE CCCEEEEECCCCHHH | 24.02 | 22276854 | |
56 | Phosphorylation | SVSYNPATAKEIVNV EEEECCCCHHHHEEC | 39.25 | 22276854 | |
88 | Phosphorylation | KGGPLADSYRLTQFH ECCCCCCEEEEEEEE | 13.42 | 30181290 | |
128 | Acetylation | LVHWNSAKYSSAAEA EEEECCCCHHHHHHH | 45.55 | 22902405 | |
129 | Phosphorylation | VHWNSAKYSSAAEAI EEECCCCHHHHHHHH | 13.94 | 22673903 | |
130 | Phosphorylation | HWNSAKYSSAAEAIS EECCCCHHHHHHHHH | 16.88 | 22673903 | |
131 | Phosphorylation | WNSAKYSSAAEAISK ECCCCHHHHHHHHHH | 28.54 | 22673903 | |
137 | Phosphorylation | SSAAEAISKADGLAI HHHHHHHHHHCCEEE | 28.92 | 22673903 | |
160 | Acetylation | PANPNLQKVLDALSS CCCCCHHHHHHHHHC | 48.18 | 22902405 | |
253 | Acetylation | HRPPQPLKGRTVRAS CCCCCCCCCCEEEEC | 53.69 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAH1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAH1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAH1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CAH1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...