| UniProt ID | CABP1_MOUSE | |
|---|---|---|
| UniProt AC | Q9JLK7 | |
| Protein Name | Calcium-binding protein 1 | |
| Gene Name | Cabp1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 227 | |
| Subcellular Localization | ||
| Protein Description | Modulates calcium-dependent activity of inositol 1,4,5-triphosphate receptors (ITPRs). Inhibits agonist-induced intracellular calcium signaling. Enhances inactivation and does not support calcium-dependent facilitation of voltage-dependent P/Q-type calcium channels (By similarity). Causes calcium-dependent facilitation and inhibits inactivation of L-type calcium channels by binding to the same sites as calmodulin in the C-terminal domain of CACNA1C, but has an opposite effect on channel function. Suppresses the calcium-dependent inactivation of CACNA1D. [PubMed: 17050707] | |
| Protein Sequence | MGNCVKSPLRNLSRKMRQEEKTSYMAVQTSEDGLADGGELHGPLMMLAQNCAVMHNLLGPACIFLRKGFAENRQPDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGNCVKSPL ------CCCHHHHHH | 35.92 | - | |
| 2 (in isoform 2) | Myristoylation | - | 35.92 | - | |
| 3 | Deamidated asparagine | -----MGNCVKSPLR -----CCCHHHHHHH | 26.55 | - | |
| 4 | S-palmitoylation | ----MGNCVKSPLRN ----CCCHHHHHHHH | 3.18 | - | |
| 4 (in isoform 2) | S-palmitoylation | - | 3.18 | - | |
| 180 | Phosphorylation | TNGDGEISTSELREA CCCCCCCCHHHHHHH | 22.90 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CABP1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CABP1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CABP1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CABP1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
