| UniProt ID | CA4_ARATH | |
|---|---|---|
| UniProt AC | P27521 | |
| Protein Name | Chlorophyll a-b binding protein 4, chloroplastic {ECO:0000303|PubMed:10366881} | |
| Gene Name | LHCA4 {ECO:0000303|PubMed:10366881} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 251 | |
| Subcellular Localization |
Plastid, chloroplast thylakoid membrane Multi-pass membrane protein . |
|
| Protein Description | The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.. | |
| Protein Sequence | MATVTTHASASIFRPCTSKPRFLTGSSGRLNRDLSFTSIGSSAKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGIFNPLNFAPTQEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTFN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Phosphorylation | GRLNRDLSFTSIGSS CCCCCCCEEEECCCC | 30.66 | 30291188 | |
| 37 | Phosphorylation | LNRDLSFTSIGSSAK CCCCCEEEECCCCCC | 18.96 | 23776212 | |
| 38 | Phosphorylation | NRDLSFTSIGSSAKT CCCCEEEECCCCCCC | 23.96 | 23776212 | |
| 41 | Phosphorylation | LSFTSIGSSAKTSSF CEEEECCCCCCCCCE | 26.00 | 19376835 | |
| 42 | Phosphorylation | SFTSIGSSAKTSSFK EEEECCCCCCCCCEE | 28.68 | 19376835 | |
| 66 | Phosphorylation | PGLASPDYLTGSLAG CCCCCCCHHCCCCCC | 15.00 | 26811356 | |
| 68 | Phosphorylation | LASPDYLTGSLAGDN CCCCCHHCCCCCCCC | 20.63 | 26811356 | |
| 70 | Phosphorylation | SPDYLTGSLAGDNGF CCCHHCCCCCCCCCC | 15.15 | 26811356 | |
| 128 | Nitration | IINVPEWYDAGKEQY CCCCCCHHHCCHHHC | 8.34 | - | |
| 166 | Phosphorylation | QDIKNPGSVNQDPIF HHCCCCCCCCCCCCH | 21.10 | 30291188 | |
| 176 | Nitration | QDPIFKQYSLPKGEV CCCCHHCCCCCCCCC | 16.86 | - | |
| 185 | Nitration | LPKGEVGYPGGIFNP CCCCCCCCCCCCCCC | 12.13 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CA4_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CA4_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CA4_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CA4_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-35, AND MASSSPECTROMETRY. | |
