| UniProt ID | CA021_HUMAN | |
|---|---|---|
| UniProt AC | Q9H246 | |
| Protein Name | Uncharacterized protein C1orf21 | |
| Gene Name | C1orf21 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 121 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MGCASAKHVATVQNEEEAQKGKNYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQENLEKSASSNVRLKTNKEVPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEEEDIT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Phosphorylation | EAQKGKNYQNGDVFG HHHHCCCCCCCCCCC | 13.57 | 25884760 | |
| 34 | Phosphorylation | GDVFGDEYRIKPVEE CCCCCCCCEECCHHH | 23.52 | 28796482 | |
| 37 | Ubiquitination | FGDEYRIKPVEEVKY CCCCCEECCHHHHCC | 33.73 | - | |
| 43 | Ubiquitination | IKPVEEVKYMKNGAE ECCHHHHCCCCCCHH | 42.79 | - | |
| 44 | Phosphorylation | KPVEEVKYMKNGAEE CCHHHHCCCCCCHHH | 20.63 | - | |
| 65 | Ubiquitination | RNQENLEKSASSNVR HHHHHHHHHHHCCCC | 55.26 | - | |
| 93 | Phosphorylation | PRANMHISESQQEFF CCCCCCCCHHHHHHH | 19.27 | 30266825 | |
| 95 | Phosphorylation | ANMHISESQQEFFRM CCCCCCHHHHHHHHH | 30.30 | 23401153 | |
| 113 | Phosphorylation | KIEKGRDYCSEEEDI HHHHCHHCCCCCCCC | 9.12 | 23927012 | |
| 115 | Phosphorylation | EKGRDYCSEEEDIT- HHCHHCCCCCCCCC- | 41.64 | 23401153 | |
| 121 | Phosphorylation | CSEEEDIT------- CCCCCCCC------- | 44.90 | 23403867 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CA021_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CA021_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CA021_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CA021_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-95 AND SER-115, AND MASSSPECTROMETRY. | |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-95 AND SER-115, AND MASSSPECTROMETRY. | |
