dbPTM

C71AG_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	C71AG_ARATH
UniProt AC	Q9FH66
Protein Name	Cytochrome P450 71A16
Gene Name	CYP71A16
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	497
Subcellular Localization	Membrane Single-pass membrane protein .
Protein Description	Possesses triterpene oxidizing activity. Catalyzes the C23 hydroxylation of marneral to form 23-hydroxymarneral. Catalyzes the C23 hydroxylation of marnerol to form 23-hydroxymarnerol..
Protein Sequence	MEMMILISLCLTTFLTILLFFKSLLKRPNSNLPPSPWRLPVIGNLHQLSLHPHRALSSLSARHGPLMLLRFGRVPVLIVSSADVAHDVMKTHDLKFANRPITKSAHKISNGGRDLVFAPYGEYWRNVKSLCTIHLLSNKMVQSSEKRREEEITLLMETLEEASLSSSSVNLSKLITNMVSDIMGKVVLGKKYSGEEGTIDVKTITKSFLDAVGLSPVGEYIPSLAWIGKITGSDGKLEKITKQFGDFIEKVLQEHEDTTADKETPDFVDMLLTIQRDETAQCQLDKSDLKVIIFEMFLGSTTTTSAVIEWAMTRLMRNPECLKKLQDEIRSVSKMNSYVSGKEVENMNYLKAVIKEVLRLHPPLPLLVPRLLSEDVKLKGYDITAGTQVIINAWAIQRDTATWGSDAQEFRPERHFDSTWDFVGRNFKYIPFGAGRRLCPGIGLGSVMASVTLANLVKRFDWRVEDGPSGYDKPDLVEGAGIDVCRKFPLVVFPSSA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
137	Phosphorylation	LCTIHLLSNKMVQSS HHHHHHHCCCHHHCC	40.54	24243849
337	Phosphorylation	RSVSKMNSYVSGKEV HHHHHHHHCCCCCCC	24.34	19880383
338	Phosphorylation	SVSKMNSYVSGKEVE HHHHHHHCCCCCCCC	8.14	19880383
349	Phosphorylation	KEVENMNYLKAVIKE CCCCCHHHHHHHHHH	9.98	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of C71AG_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of C71AG_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of C71AG_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of C71AG_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of C71AG_ARATH

Related Literatures of Post-Translational Modification