BYR3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BYR3_SCHPO
• UniProt AC: P36627
• Protein Name: Cellular nucleic acid-binding protein homolog
• Gene Name: byr3
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 179
• Subcellular Localization: Nucleus .
• Protein Description: Acts in the sexual differentiation pathway. Is required for efficient conjugation. Double-stranded DNA-binding protein..
• Protein Sequence: MESESVPTVPQTTRPGPRCYNCGENGHQARECTKGSICYNCNQTGHKASECTEPQQEKTCYACGTAGHLVRDCPSSPNPRQGAECYKCGRVGHIARDCRTNGQQSGGRFGGHRSNMNCYACGSYGHQARDCTMGVKCYSCGKIGHRSFECQQASDGQLCYKCNQPGHIAVNCTSPVIEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MESESVPTVP -----CCCCCCCCCC	33.60	29996109
75	Phosphorylation	HLVRDCPSSPNPRQG HHHHCCCCCCCCCCC	65.83	29996109
76	Phosphorylation	LVRDCPSSPNPRQGA HHHCCCCCCCCCCCC	17.53	29996109
123	Phosphorylation	MNCYACGSYGHQARD CCEEECCCCCCCCCC	28.02	29996109
154	Phosphorylation	SFECQQASDGQLCYK CEEEEECCCCCEEEE	37.63	25720772
173	Phosphorylation	GHIAVNCTSPVIEA- CEEEEECCCCCCCC-	30.75	25720772
174	Phosphorylation	HIAVNCTSPVIEA-- EEEEECCCCCCCC--	21.26	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BYR3_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BYR3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BYR3_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of BYR3_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.