UniProt ID | BTG4_HUMAN | |
---|---|---|
UniProt AC | Q9NY30 | |
Protein Name | Protein BTG4 | |
Gene Name | BTG4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 223 | |
Subcellular Localization | ||
Protein Description | Shows marked antiproliferative activity, being able to induce G(1) arrest.. | |
Protein Sequence | MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVENLKQPFQSWLQIPRKKNVVDGRVGLLGNTYHGSQKHPKCYRPAMHRLDRIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | ATTVFFVTRLVKKHD HHHHHHHHHHHHHHH | 17.09 | - | |
53 | Acetylation | WHSDCPSKGQAFRCI CCCCCCCCCCEEEEE | 39.94 | 19818161 | |
116 | Phosphorylation | NHPFTVASFKGRWEE CCCEEEEEECCCHHH | 24.13 | 24719451 | |
139 | Phosphorylation | YAVSRASSDVSSGTS HHHHHCCCCCCCCCC | 40.84 | 30576142 | |
153 | Phosphorylation | SCDEESCSKEPRVIP CCCHHHHCCCCCCCC | 49.70 | 30576142 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BTG4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BTG4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BTG4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BTG4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...