UniProt ID | BTF3_MOUSE | |
---|---|---|
UniProt AC | Q64152 | |
Protein Name | Transcription factor BTF3 | |
Gene Name | Btf3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 204 | |
Subcellular Localization | Cytoplasm. Nucleus. The heterodimer with NACA is cytoplasmic.. | |
Protein Description | When associated with NACA, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. BTF3 is also a general transcription factor that can form a stable complex with RNA polymerase II. Required for the initiation of transcription (By similarity).. | |
Protein Sequence | MRRTGAPTQADSRGRGRARGGWPGAEATPSLPLGGSRGRESQMKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | GAPTQADSRGRGRAR CCCCCCCCCCCCCCC | 39.38 | 20531401 | |
19 | Methylation | SRGRGRARGGWPGAE CCCCCCCCCCCCCCC | 42.68 | 24129315 | |
30 | Phosphorylation | PGAEATPSLPLGGSR CCCCCCCCCCCCCCC | 37.96 | - | |
36 | Phosphorylation | PSLPLGGSRGRESQM CCCCCCCCCCCHHHH | 29.75 | 28066266 | |
44 | Methylation | RGRESQMKETIMNQE CCCHHHHHHHHHCHH | 44.03 | - | |
52 | Methylation | ETIMNQEKLAKLQAQ HHHHCHHHHHHHHHH | 43.94 | - | |
52 | Ubiquitination | ETIMNQEKLAKLQAQ HHHHCHHHHHHHHHH | 43.94 | 22790023 | |
55 | Malonylation | MNQEKLAKLQAQVRI HCHHHHHHHHHHHCC | 52.12 | 26320211 | |
55 | Succinylation | MNQEKLAKLQAQVRI HCHHHHHHHHHHHCC | 52.12 | - | |
55 | Acetylation | MNQEKLAKLQAQVRI HCHHHHHHHHHHHCC | 52.12 | 23806337 | |
55 | Ubiquitination | MNQEKLAKLQAQVRI HCHHHHHHHHHHHCC | 52.12 | - | |
65 | Acetylation | AQVRIGGKGTARRKK HHHCCCCCCHHHHCC | 48.12 | 23806337 | |
67 | Phosphorylation | VRIGGKGTARRKKKV HCCCCCCHHHHCCEE | 22.07 | - | |
80 | Phosphorylation | KVVHRTATADDKKLQ EEEEEECCCCHHHHH | 29.97 | 18779572 | |
85 | Ubiquitination | TATADDKKLQFSLKK ECCCCHHHHHHHHHH | 55.29 | 22790023 | |
91 | Ubiquitination | KKLQFSLKKLGVNNI HHHHHHHHHHCCCCC | 44.76 | 22790023 | |
99 | Phosphorylation | KLGVNNISGIEEVNM HHCCCCCCCCEEEEE | 35.52 | 26643407 | |
142 | Phosphorylation | HAETKQLTEMLPSIL CHHHHHHHHHHHHHH | 19.49 | 22817900 | |
147 | Phosphorylation | QLTEMLPSILNQLGA HHHHHHHHHHHHHCC | 35.43 | 21149613 | |
156 | Phosphorylation | LNQLGADSLTSLRRL HHHHCCHHHHHHHHH | 32.77 | 28507225 | |
158 | Phosphorylation | QLGADSLTSLRRLAE HHCCHHHHHHHHHHH | 29.66 | 21149613 | |
159 | Phosphorylation | LGADSLTSLRRLAEA HCCHHHHHHHHHHHH | 25.77 | 21149613 | |
169 | Ubiquitination | RLAEALPKQSVDGKA HHHHHCCCCCCCCCC | 56.93 | - | |
169 | Malonylation | RLAEALPKQSVDGKA HHHHHCCCCCCCCCC | 56.93 | 26320211 | |
171 | Phosphorylation | AEALPKQSVDGKAPL HHHCCCCCCCCCCCC | 28.44 | 26824392 | |
175 | Ubiquitination | PKQSVDGKAPLATGE CCCCCCCCCCCCCCC | 42.22 | - | |
180 | Phosphorylation | DGKAPLATGEDDDDE CCCCCCCCCCCCCCC | 49.11 | 25338131 | |
199 | Phosphorylation | VENFDEASKNEAN-- HHHHHHHHHHCCC-- | 33.69 | 30352176 | |
200 | Ubiquitination | ENFDEASKNEAN--- HHHHHHHHHCCC--- | 66.89 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BTF3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BTF3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BTF3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BTF3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...