BTBD8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BTBD8_HUMAN
• UniProt AC: Q5XKL5
• Protein Name: BTB/POZ domain-containing protein 8
• Gene Name: BTBD8
• Organism: Homo sapiens (Human).
• Sequence Length: 378
• Subcellular Localization: Nucleus . Localized to nucleus in fetal cells.
• Protein Sequence: MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFKAHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPCCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQILNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFWSERSFANIPPEIQKSCLNMLIQSLVSIT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
225	Phosphorylation	KAHRAILSARSSYFA HHHHHHHHHHHHHHH	18.61	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BTBD8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BTBD8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BTBD8_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of BTBD8_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.