dbPTM

BT2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BT2_ARATH
UniProt AC	Q94BN0
Protein Name	BTB/POZ and TAZ domain-containing protein 2
Gene Name	BT2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	364
Subcellular Localization	Nucleus . Cytoplasm .
Protein Description	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Plays a key role as a component of the TAC1-mediated telomerase activation pathway certainly by targeting a telomerase repressor to degradation. Seems to occupy an integral position in a complex signaling network that perceives, integrates, and responds to multiple, and sometimes competing, signals. Enhances responses to auxin in postgermination and vegetative development. Also negatively regulates ABA- and sugar-mediated inhibition of the germination. Essential for female and male gametophyte development..
Protein Sequence	MEAVLVAMSVPATTEDDGFSLITDKLSYNLTPTSDVEIVTSDNRRIPAHSGVLASASPVLMNIMKKPMRRYRGCGSKRVIKILGVPCDAVSVFIKFLYSSSLTEDEMERYGIHLLALSHVYMVTQLKQRCSKGVVQRLTTENVVDVLQLARLCDAPDVCLRSMRLIHSQFKTVEQTEGWKFIQEHDPFLELDILQFIDDAESRKKRRRRHRKEQDLYMQLSEAMECIEHICTQGCTLVGPSNVVDNNKKSMTAEKSEPCKAFSTCYGLQLLIRHFAVCKRRNNDKGCLRCKRMLQLFRLHSLICDQPDSCRVPLCRQFRKRGEQDKKMGEDTKWKLLVTRVVSAKAMTSLCQSKKNKCEQAQGV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of BT2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BT2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BT2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BT2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
GTE11_ARATH	BET10	physical	15316289

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BT2_ARATH

Related Literatures of Post-Translational Modification