BSH_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BSH_MOUSE
• UniProt AC: Q810B3
• Protein Name: Brain-specific homeobox protein homolog
• Gene Name: Bsx {ECO:0000312|EMBL:AAO84023.1}
• Organism: Mus musculus (Mouse).
• Sequence Length: 232
• Subcellular Localization: Isoform 1: Nucleus .; Isoform 2: Cytoplasm .
• Protein Description: DNA binding protein that function as transcriptional activator. Is essential for normal postnatal growth and nursing. Is an essential factor for neuronal neuropeptide Y and agouti-related peptide function and locomotory behavior in the control of energy balance..
• Protein Sequence: MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMPTPTLLTPHAHHPLHKGDHHHPYFLTTSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVLTEPEDEVDIGDEGELSSGPHVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MNLNFTSPLHPASS -CCCCCCCCCCCCCC	22.71	30635358
13	Phosphorylation	TSPLHPASSQRPTSF CCCCCCCCCCCCCEE	31.30	30635358
14	Phosphorylation	SPLHPASSQRPTSFF CCCCCCCCCCCCEEE	32.11	30635358

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BSH_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BSH_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BSH_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CREB1_MOUSE	Creb1	physical	17550780
FOXO1_MOUSE	Foxo1	physical	17550780

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.