BSD2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BSD2_SCHPO
• UniProt AC: Q9P3T9
• Protein Name: Probable metal homeostasis protein bsd1
• Gene Name: bsd1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 277
• Subcellular Localization: Endoplasmic reticulum . Vacuole . Membrane ; Multi-pass membrane protein .
• Protein Description: Required for homeostasis of heavy metal ions such as cadmium, cobalt and copper..
• Protein Sequence: MSTNSNQNSIHTPIPEFPENRSTNRSELAAAFEPPDDDVEYSETAPLYSSARASIEGEEAFYQHLSTPDPGNDSGHVRSSNDRIPSTSSNHADGHHVDSVFSNLSAKPTVESNTEELEEEPPSYEQAAADTAPPYWDTTMVIPDYGSNEIYIDGMSVGTGFSFVWSACVAILFPFVGFLVTYVLSTTHLGRYGAQIGLSLTLFQRGYIMISESGMENNDDQYNYDELPHQKLIGSILIIIGWCLVLVDTFGFIRIRRMKNAISRTDSPGETSPEEVV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSTNSNQNS ------CCCCCCCCC	35.97	19547744
50	Phosphorylation	ETAPLYSSARASIEG CCCCCCCHHHHHCCC	14.28	25720772
54	Phosphorylation	LYSSARASIEGEEAF CCCHHHHHCCCHHHH	18.67	29996109
67	Phosphorylation	AFYQHLSTPDPGNDS HHHHHCCCCCCCCCC	37.76	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BSD2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BSD2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BSD2_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of BSD2_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.