UniProt ID | BSD2_SCHPO | |
---|---|---|
UniProt AC | Q9P3T9 | |
Protein Name | Probable metal homeostasis protein bsd1 | |
Gene Name | bsd1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 277 | |
Subcellular Localization |
Endoplasmic reticulum . Vacuole . Membrane Multi-pass membrane protein . |
|
Protein Description | Required for homeostasis of heavy metal ions such as cadmium, cobalt and copper.. | |
Protein Sequence | MSTNSNQNSIHTPIPEFPENRSTNRSELAAAFEPPDDDVEYSETAPLYSSARASIEGEEAFYQHLSTPDPGNDSGHVRSSNDRIPSTSSNHADGHHVDSVFSNLSAKPTVESNTEELEEEPPSYEQAAADTAPPYWDTTMVIPDYGSNEIYIDGMSVGTGFSFVWSACVAILFPFVGFLVTYVLSTTHLGRYGAQIGLSLTLFQRGYIMISESGMENNDDQYNYDELPHQKLIGSILIIIGWCLVLVDTFGFIRIRRMKNAISRTDSPGETSPEEVV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTNSNQNS ------CCCCCCCCC | 35.97 | 19547744 | |
50 | Phosphorylation | ETAPLYSSARASIEG CCCCCCCHHHHHCCC | 14.28 | 25720772 | |
54 | Phosphorylation | LYSSARASIEGEEAF CCCHHHHHCCCHHHH | 18.67 | 29996109 | |
67 | Phosphorylation | AFYQHLSTPDPGNDS HHHHHCCCCCCCCCC | 37.76 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BSD2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BSD2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BSD2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BSD2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...