BRX1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BRX1_MOUSE
• UniProt AC: Q9DCA5
• Protein Name: Ribosome biogenesis protein BRX1 homolog
• Gene Name: Brix1
• Organism: Mus musculus (Mouse).
• Sequence Length: 353
• Subcellular Localization: Nucleus, nucleolus.
• Protein Description: Required for biogenesis of the 60S ribosomal subunit..
• Protein Sequence: MAATKRKRRGGLEVQAKKPKRSSKDAGQPAKQADVAKEAEEENRDRIPGPVCKGKWKNKERILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEAKKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDDLPHYALLKEFLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSPNMHRRVIRSITAAKYRERQQVKDVQKLRKKEPKTILPHDPTADVFVIPAEEKPVEIQWVKPEPKVDLKARKRRIYKRHRKLQQKMSRGSAK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	AKKPKRSSKDAGQPA ECCCCCCCCCCCCCH	38.29	23684622
259	Phosphorylation	TLYENPHYQSPNMHR CCCCCCCCCCCCHHH	16.37	25159016
261	Phosphorylation	YENPHYQSPNMHRRV CCCCCCCCCCHHHHH	15.86	25159016
276	Acetylation	IRSITAAKYRERQQV HHHHHHHHHHHHHHH	42.23	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BRX1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BRX1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BRX1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of BRX1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.