BRX1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BRX1_DROME
• UniProt AC: Q9VZE6
• Protein Name: Ribosome biogenesis protein BRX1 homolog
• Gene Name: CG11583
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 359
• Subcellular Localization: Nucleus, nucleolus.
• Protein Description: Required for biogenesis of the 60S ribosomal subunit..
• Protein Sequence: MGRKFQNKKKKAAPQLEIVPLDENPPLPPQRSSDDVVPKKARKEKWVNKQRVLVFSARGISHRDRHLMKDIKTLMPHHRPESKMERSKTLSVVNEMCEMKHCNKAMLFEGRRKRDLYMWISNTSGSTGPSAKFLIENIHTMAELKMTGNCLRGSRPLLSFDSKFDELPHLKLLKELFVQTYSVPNHHPKSQPFVDHVFTFTYLDKRIWFRNFQILSEDGGLSEVGPRYVMNPVKIFDGSFTGKTIWENPDYVSPSKQRQVLKKAAKDKYVNRVEQKVKHEATRPIRAYDGMDNDELFEDDDPVETAKILAAIAKKKKEEAAKQTPKSALTKKIKEKQLQAVKDVIERKKARTIKRVKKV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
255	Phosphorylation	NPDYVSPSKQRQVLK CCCCCCHHHHHHHHH	33.64	22668510

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BRX1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BRX1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BRX1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.