dbPTM

BRK1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BRK1_MOUSE
UniProt AC	Q91VR8
Protein Name	Protein BRICK1
Gene Name	Brk1
Organism	Mus musculus (Mouse).
Sequence Length	75
Subcellular Localization	Cytoplasm, cytoskeleton.
Protein Description	Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex (By similarity). As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes. [PubMed: 27605705]
Protein Sequence	MAGQEDPVQREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGQEDPVQ ------CCCCCCHHH	28.51	-
26	Phosphorylation	REYIEIITSSIKKIS HHHHHHHHHHHHHHH	23.29	26824392
27	Phosphorylation	EYIEIITSSIKKISD HHHHHHHHHHHHHHH	21.47	26824392
28	Phosphorylation	YIEIITSSIKKISDF HHHHHHHHHHHHHHH	29.76	26824392
30	Ubiquitination	EIITSSIKKISDFLN HHHHHHHHHHHHHHH	46.10	22790023
31	Ubiquitination	IITSSIKKISDFLNS HHHHHHHHHHHHHHH	45.86	22790023
63	Phosphorylation	ALERRIEYIEARVTK HHHHHHHHHHHHHCC	11.16	29895711
73	Phosphorylation	ARVTKGETLT----- HHHCCCCCCC-----	44.35	29895711
75	Phosphorylation	VTKGETLT------- HCCCCCCC-------	43.94	29895711

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BRK1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BRK1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BRK1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of BRK1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BRK1_MOUSE

Related Literatures of Post-Translational Modification