dbPTM

BRI3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BRI3_HUMAN
UniProt AC	O95415
Protein Name	Brain protein I3
Gene Name	BRI3
Organism	Homo sapiens (Human).
Sequence Length	125
Subcellular Localization	Lysosome membrane Multi-pass membrane protein .
Protein Description	Participates in tumor necrosis factor-alpha (TNF)-induced cell death. [PubMed: 14592447 May be a target of Wnt/beta-catenin signaling in the liver]
Protein Sequence	MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Ubiquitination	----MDHKPLLQERP ----CCCCHHHCCCC	32.85	29901268
23	Phosphorylation	LEAGQGDYACGPHGY CCCCCCCCCCCCCCC	15.60	-
57	Phosphorylation	PTHHPRVYNIHSRTV CCCCCCEEEEECCEE	15.07	22817900
61	Phosphorylation	PRVYNIHSRTVTRYP CCEEEEECCEEEECC	26.33	27642862
63	Phosphorylation	VYNIHSRTVTRYPAN EEEEECCEEEECCCC	29.28	28857561
65	Phosphorylation	NIHSRTVTRYPANSI EEECCEEEECCCCEE	24.71	28857561
67	Phosphorylation	HSRTVTRYPANSIVV ECCEEEECCCCEEEE	9.42	28857561
71	Phosphorylation	VTRYPANSIVVVGGC EEECCCCEEEEECCC	20.90	28857561

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BRI3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BRI3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BRI3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
BACE1_MOUSE	Bace1	physical	15606899

Drug and Disease Associations

Kegg Disease
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BRI3_HUMAN

Related Literatures of Post-Translational Modification