UniProt ID | BPNT1_MOUSE | |
---|---|---|
UniProt AC | Q9Z0S1 | |
Protein Name | 3'(2'),5'-bisphosphate nucleotidase 1 | |
Gene Name | Bpnt1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 308 | |
Subcellular Localization | ||
Protein Description | Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.. | |
Protein Sequence | MASSHTVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAALGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLAALRNYEYYASHVPESVKNALIP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASSHTVLM ------CCCCHHHHH | 21.53 | - | |
3 | Phosphorylation | -----MASSHTVLMR -----CCCCHHHHHH | 22.73 | 24759943 | |
4 | Phosphorylation | ----MASSHTVLMRL ----CCCCHHHHHHH | 17.40 | 24759943 | |
42 | Phosphorylation | LGIVQKTSATDLQTK EEEEECCCCHHHHHH | 35.89 | 25521595 | |
49 | Ubiquitination | SATDLQTKADRLVQM CCHHHHHHHHHHHHH | 35.02 | - | |
49 | Malonylation | SATDLQTKADRLVQM CCHHHHHHHHHHHHH | 35.02 | 26320211 | |
59 | S-nitrosylation | RLVQMSICSSLARKF HHHHHHHHHHHHHHC | 1.45 | 21278135 | |
59 | S-nitrosocysteine | RLVQMSICSSLARKF HHHHHHHHHHHHHHC | 1.45 | - | |
122 | Phosphorylation | WVDPLDGTKEYTEGL EECCCCCCHHHHCCH | 21.99 | 27180971 | |
189 | Ubiquitination | LKEAPAGKHIITTTR EEECCCCCEEEEECC | 33.46 | - | |
189 | Malonylation | LKEAPAGKHIITTTR EEECCCCCEEEEECC | 33.46 | 26320211 | |
193 | Phosphorylation | PAGKHIITTTRSHSN CCCCEEEEECCCCCC | 22.85 | 20469934 | |
194 | Phosphorylation | AGKHIITTTRSHSNQ CCCEEEEECCCCCCC | 15.14 | 20469934 | |
195 | Phosphorylation | GKHIITTTRSHSNQL CCEEEEECCCCCCCC | 22.86 | 20469934 | |
197 | Phosphorylation | HIITTTRSHSNQLVT EEEEECCCCCCCCHH | 29.22 | 22817900 | |
199 | Phosphorylation | ITTTRSHSNQLVTDC EEECCCCCCCCHHHH | 27.76 | 25293948 | |
206 | S-nitrosylation | SNQLVTDCISAMNPD CCCCHHHHHHHCCCC | 1.61 | 21278135 | |
206 | S-nitrosocysteine | SNQLVTDCISAMNPD CCCCHHHHHHHCCCC | 1.61 | - | |
236 | Phosphorylation | IEGKASAYVFASPGC EECCCEEEEEECCCC | 8.13 | - | |
240 | Phosphorylation | ASAYVFASPGCKKWD CEEEEEECCCCCCCC | 15.45 | 26745281 | |
243 | S-nitrosylation | YVFASPGCKKWDTCA EEEECCCCCCCCCCC | 4.68 | 21278135 | |
243 | S-nitrosocysteine | YVFASPGCKKWDTCA EEEECCCCCCCCCCC | 4.68 | - | |
244 | Ubiquitination | VFASPGCKKWDTCAP EEECCCCCCCCCCCH | 63.91 | - | |
244 | Succinylation | VFASPGCKKWDTCAP EEECCCCCCCCCCCH | 63.91 | - | |
244 | Acetylation | VFASPGCKKWDTCAP EEECCCCCCCCCCCH | 63.91 | 23806337 | |
244 | Malonylation | VFASPGCKKWDTCAP EEECCCCCCCCCCCH | 63.91 | 26320211 | |
244 | Succinylation | VFASPGCKKWDTCAP EEECCCCCCCCCCCH | 63.91 | 23806337 | |
245 | Acetylation | FASPGCKKWDTCAPE EECCCCCCCCCCCHH | 55.14 | 22826441 | |
249 | S-nitrosylation | GCKKWDTCAPEVILH CCCCCCCCCHHHHHH | 5.72 | 21278135 | |
249 | S-nitrosocysteine | GCKKWDTCAPEVILH CCCCCCCCCHHHHHH | 5.72 | - | |
293 | Phosphorylation | AALRNYEYYASHVPE HHHHCHHHHHHCCCH | 8.25 | 17242355 | |
296 | Phosphorylation | RNYEYYASHVPESVK HCHHHHHHCCCHHHH | 14.64 | 17242355 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BPNT1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BPNT1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BPNT1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BPNT1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...