UniProt ID | BPIB2_HUMAN | |
---|---|---|
UniProt AC | Q8N4F0 | |
Protein Name | BPI fold-containing family B member 2 | |
Gene Name | BPIFB2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 458 | |
Subcellular Localization | Secreted. | |
Protein Description | ||
Protein Sequence | MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNALLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Phosphorylation | VGASTPGTVVRLNKA HCCCCCCHHHHCCHH | 19.61 | 22210691 | |
35 | Phosphorylation | RLNKAALSYVSEIGK HCCHHHHHHHHHHCC | 20.82 | - | |
36 | Phosphorylation | LNKAALSYVSEIGKA CCHHHHHHHHHHCCC | 14.62 | - | |
38 | Phosphorylation | KAALSYVSEIGKAPL HHHHHHHHHHCCCHH | 18.44 | 22210691 | |
52 | Phosphorylation | LQRALQVTVPHFLDW HHHHHHCCCCCCCCC | 18.50 | 26091039 | |
60 | Phosphorylation | VPHFLDWSGEALQPT CCCCCCCCCCCCCCE | 26.82 | 26091039 | |
96 | N-linked_Glycosylation | VRLLAAANFTFKVFR HHHHHHCCCEEEEEE | 31.59 | 16740002 | |
96 | N-linked_Glycosylation | VRLLAAANFTFKVFR HHHHHHCCCEEEEEE | 31.59 | 17623646 | |
151 | N-linked_Glycosylation | ANEFDGSNSTSHALL CCCCCCCCCHHHHHH | 55.63 | UniProtKB CARBOHYD | |
209 | Phosphorylation | QIRYSMVSVPTVTSD HHCEEEEECCCCCCC | 17.46 | 25332170 | |
212 | Phosphorylation | YSMVSVPTVTSDYIS EEEEECCCCCCCCEE | 33.97 | 25332170 | |
293 | N-linked_Glycosylation | RSDDNLLNTSALGRL CCCCCCCCHHHHHHH | 34.84 | 17623646 | |
293 | N-linked_Glycosylation | RSDDNLLNTSALGRL CCCCCCCCHHHHHHH | 34.84 | 16740002 | |
330 | Phosphorylation | TPVAMLHTNNATLRL CEEEEEECCCCEEEC | 26.63 | - | |
332 | N-linked_Glycosylation | VAMLHTNNATLRLQP EEEEECCCCEEECHH | 35.14 | 16740002 | |
332 | N-linked_Glycosylation | VAMLHTNNATLRLQP EEEEECCCCEEECHH | 35.14 | 17623646 | |
334 | Phosphorylation | MLHTNNATLRLQPFV EEECCCCEEECHHHH | 17.97 | - | |
346 | Phosphorylation | PFVEVLATASNSAFQ HHHHHHHHCCCHHHH | 26.85 | 27174698 | |
348 | Phosphorylation | VEVLATASNSAFQSL HHHHHHCCCHHHHHH | 27.28 | 27174698 | |
350 | Phosphorylation | VLATASNSAFQSLFS HHHHCCCHHHHHHCC | 28.15 | 27174698 | |
354 | Phosphorylation | ASNSAFQSLFSLDVV CCCHHHHHHCCCHHE | 25.57 | 27174698 | |
357 | Phosphorylation | SAFQSLFSLDVVVNL HHHHHHCCCHHEEEE | 29.02 | 27174698 | |
369 | Phosphorylation | VNLRLQLSVSKVKLQ EEEEEEEEEEEEEEE | 16.04 | 24719451 | |
371 | Phosphorylation | LRLQLSVSKVKLQGT EEEEEEEEEEEEECC | 28.49 | 27174698 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BPIB2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BPIB2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BPIB2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Identification of N-linked glycoproteins in human saliva byglycoprotein capture and mass spectrometry."; Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T.,Loo J.A.; J. Proteome Res. 5:1493-1503(2006). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-96; ASN-293 AND ASN-332,AND MASS SPECTROMETRY. |