UniProt ID | BORG1_MOUSE | |
---|---|---|
UniProt AC | Q8JZX9 | |
Protein Name | Cdc42 effector protein 2 | |
Gene Name | Cdc42ep2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 214 | |
Subcellular Localization |
Endomembrane system Peripheral membrane protein. Cytoplasm, cytoskeleton. |
|
Protein Description | Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts in a CDC42-dependent manner (By similarity).. | |
Protein Sequence | MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGDDMFGDISFLQGKFHLLPGTAVEEAEEDGSFDLPFQFTRTTTVCGRELPDGLSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLESPQPSPQPSPQGAGNVDVWRIPEAGSPHNGMSPEPEAEEPFLSHASSLLSLHVDLGPSILDDVLQIMDHDLGRVQIPT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTKVPIYL ------CCCCCCEEE | 36.61 | 29176673 | |
2 | Acetylation | ------MSTKVPIYL ------CCCCCCEEE | 36.61 | - | |
3 | Phosphorylation | -----MSTKVPIYLK -----CCCCCCEEEC | 34.46 | 29176673 | |
8 | Phosphorylation | MSTKVPIYLKRGSRK CCCCCCEEECCCCCC | 10.49 | 29514104 | |
13 | Phosphorylation | PIYLKRGSRKGKKEK CEEECCCCCCCCHHH | 34.55 | 29514104 | |
26 | Phosphorylation | EKLRDLLSSDMISPP HHHHHHHCCCCCCCC | 31.43 | 29514104 | |
31 | Phosphorylation | LLSSDMISPPLGDFR HHCCCCCCCCCCCCC | 17.52 | 29514104 | |
78 | Phosphorylation | EEAEEDGSFDLPFQF CCCCCCCCCCCCEEE | 28.10 | 26824392 | |
90 | Phosphorylation | FQFTRTTTVCGRELP EEEEEEEEECCCCCC | 17.12 | 29514104 | |
101 | Phosphorylation | RELPDGLSPLLKNAI CCCCCCCCHHHHHCC | 21.02 | 27180971 | |
109 | Phosphorylation | PLLKNAISLPVIGGP HHHHHCCCCCCCCCC | 24.98 | 25521595 | |
120 | Phosphorylation | IGGPQALTLPTAQAP CCCCCCEECCCCCCC | 33.44 | 25777480 | |
123 | Phosphorylation | PQALTLPTAQAPPKP CCCEECCCCCCCCCC | 34.22 | 25777480 | |
137 | Phosphorylation | PPRLHLESPQPSPQP CCCCCCCCCCCCCCC | 34.88 | 27087446 | |
141 | Phosphorylation | HLESPQPSPQPSPQG CCCCCCCCCCCCCCC | 30.81 | 27087446 | |
145 | Phosphorylation | PQPSPQPSPQGAGNV CCCCCCCCCCCCCCE | 25.30 | 27087446 | |
182 | Phosphorylation | EPFLSHASSLLSLHV CCHHHHHHHHHHHCC | 18.98 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
101 | S | Phosphorylation | Kinase | MAPK1 | P63085 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BORG1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BORG1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BORG1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"The phagosomal proteome in interferon-gamma-activated macrophages."; Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.; Immunity 30:143-154(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-137; SER-141 ANDSER-145, AND MASS SPECTROMETRY. |