UniProt ID | BORC8_HUMAN | |
---|---|---|
UniProt AC | Q96FH0 | |
Protein Name | BLOC-1-related complex subunit 8 {ECO:0000305} | |
Gene Name | BORCS8 {ECO:0000312|HGNC:HGNC:37247} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 119 | |
Subcellular Localization | Lysosome membrane . | |
Protein Description | As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor.. | |
Protein Sequence | MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Ubiquitination | EEPEMQLKGKKVTDK CCCCCCCCCCCCCHH | - | ||
18 | Phosphorylation | KKVTDKFTESVYVLA CCCCHHHCCCEEHHC | 25002506 | ||
20 | Phosphorylation | VTDKFTESVYVLANE CCHHHCCCEEHHCCC | 25002506 | ||
22 | Phosphorylation | DKFTESVYVLANEPS HHHCCCEEHHCCCCC | 25002506 | ||
29 | Phosphorylation | YVLANEPSVALYRLQ EHHCCCCCHHHHHHH | 25002506 | ||
33 | Phosphorylation | NEPSVALYRLQEHVR CCCCHHHHHHHHHHH | 25002506 | ||
42 | Phosphorylation | LQEHVRRSLPELAQH HHHHHHHHHHHHHHH | 25159151 | ||
50 | Ubiquitination | LPELAQHKADMQRWE HHHHHHHHHHHHHHH | 27667366 | ||
92 | Ubiquitination | RSVEGLLKQAISIRD HCHHHHHHHHHHHHH | 32142685 | ||
104 | Phosphorylation | IRDHMNASAQGHSPE HHHHHCHHCCCCCCC | 30108239 | ||
109 | Phosphorylation | NASAQGHSPEEPPPP CHHCCCCCCCCCCCC | 25159151 | ||
117 | Phosphorylation | PEEPPPPSSA----- CCCCCCCCCC----- | 23911959 | ||
118 | Phosphorylation | EEPPPPSSA------ CCCCCCCCC------ | 25159151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BORC8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BORC8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BORC8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BORC8_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...