UniProt ID | BORC7_HUMAN | |
---|---|---|
UniProt AC | Q96B45 | |
Protein Name | BLOC-1-related complex subunit 7 {ECO:0000305} | |
Gene Name | BORCS7 {ECO:0000312|HGNC:HGNC:23516} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 105 | |
Subcellular Localization | Lysosome membrane . | |
Protein Description | As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor.. | |
Protein Sequence | MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATGTPESQ ------CCCCCHHHH | - | ||
3 | Phosphorylation | -----MATGTPESQA -----CCCCCHHHHH | 26074081 | ||
5 | Phosphorylation | ---MATGTPESQARF ---CCCCCHHHHHHH | 30576142 | ||
6 | Phosphorylation | --MATGTPESQARFG --CCCCCHHHHHHHC | 19413330 | ||
8 | Phosphorylation | MATGTPESQARFGQS CCCCCHHHHHHHCHH | 26074081 | ||
18 | Ubiquitination | RFGQSVKGLLTEKVT HHCHHHHHHHHHCCC | - | ||
36 | Ubiquitination | TDVIALTKQVLKGSR HHHHHHHHHHHHCCC | - | ||
37 | Ubiquitination | DVIALTKQVLKGSRS HHHHHHHHHHHCCCC | - | ||
42 | Phosphorylation | TKQVLKGSRSSELLG HHHHHHCCCCHHHHH | 25159151 | ||
44 | Phosphorylation | QVLKGSRSSELLGQA HHHHCCCCHHHHHHH | 30266825 | ||
45 | Phosphorylation | VLKGSRSSELLGQAA HHHCCCCHHHHHHHH | 30266825 | ||
46 | Phosphorylation | LKGSRSSELLGQAAR HHCCCCHHHHHHHHH | 18669648 | ||
65 | Phosphorylation | QEDAILHSEDSLRKM CHHHHHCCHHHHHHH | 27251275 | ||
68 | Phosphorylation | AILHSEDSLRKMAII HHHCCHHHHHHHHHH | 26091039 | ||
69 | Phosphorylation | ILHSEDSLRKMAIIT HHCCHHHHHHHHHHH | 27251275 | ||
106 | Ubiquitination | QLNHLLK-------- HHHHHHC-------- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BORC7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BORC7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BORC7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BORC7_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...