UniProt ID | BORC5_MOUSE | |
---|---|---|
UniProt AC | Q9D920 | |
Protein Name | BLOC-1-related complex subunit 5 {ECO:0000305} | |
Gene Name | Borcs5 {ECO:0000312|MGI:MGI:1915024} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 195 | |
Subcellular Localization |
Lysosome membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Thereby, it may indirectly play a role in cell spreading and motility.. | |
Protein Sequence | MGSEQSAEAESRPGDLNASVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFCFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLMERLNSMLPEAERLEPFSMKPERERH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGSEQSAEA ------CCCHHHHCH | - | ||
19 | Phosphorylation | RPGDLNASVTPSPAK CCCCCCCCCCCCHHH | 20415495 | ||
21 | Phosphorylation | GDLNASVTPSPAKHR CCCCCCCCCCHHHHC | 28066266 | ||
23 | Phosphorylation | LNASVTPSPAKHRAK CCCCCCCCHHHHCCC | 23384938 | ||
30 | Ubiquitination | SPAKHRAKMDDIVVV CHHHHCCCCCCEEEE | - | ||
44 | Phosphorylation | VAQGSQASRNVSNDP EECCCHHHCCCCCCC | 21454597 | ||
71 | Phosphorylation | PLLKGLLSGQTSPTN HHHHHHHCCCCCCCC | 22324799 | ||
74 | Phosphorylation | KGLLSGQTSPTNAKL HHHHCCCCCCCCHHH | 25521595 | ||
75 | Phosphorylation | GLLSGQTSPTNAKLE HHHCCCCCCCCHHHH | 25521595 | ||
77 | Phosphorylation | LSGQTSPTNAKLEKL HCCCCCCCCHHHHHC | 25521595 | ||
166 | Phosphorylation | IQMGIDQTVPLMERL HHHCCCCHHHHHHHH | 24759943 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BORC5_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
2 | G | Myristoylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BORC5_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BORC5_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...