BOLA2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BOLA2_MOUSE
• UniProt AC: Q8BGS2
• Protein Name: BolA-like protein 2
• Gene Name: Bola2
• Organism: Mus musculus (Mouse).
• Sequence Length: 86
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins. Acts together with the monothiol glutaredoxin GLRX3..
• Protein Sequence: MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECLAEELPHIHAFEQKTLTPEQWTRQRRE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MELSADYL -------CCCCHHHH	12.03	-
4	Phosphorylation	----MELSADYLREK ----CCCCHHHHHHH	13.04	26824392
7	Phosphorylation	-MELSADYLREKLRQ -CCCCHHHHHHHHHH	13.84	26824392
41	Phosphorylation	SFRVLVVSAKFEGKP CEEEEEEEEEECCCC	20.47	24759943
47	Succinylation	VSAKFEGKPLLQRHR EEEEECCCCHHHHHH	25.87	23954790
59	Glutathionylation	RHRLVNECLAEELPH HHHHHHHHHHHHCCC	3.53	24333276

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BOLA2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BOLA2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BOLA2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of BOLA2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.