| UniProt ID | BOLA2_HUMAN | |
|---|---|---|
| UniProt AC | Q9H3K6 | |
| Protein Name | BolA-like protein 2 | |
| Gene Name | BOLA2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 86 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins. [PubMed: 26613676] | |
| Protein Sequence | MELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRLVNACLAEELPHIHAFEQKTLTPDQWARERQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Sulfoxidation | -------MELSAEYL -------CCCCHHHH | 12.03 | 28465586 | |
| 1 | Acetylation | -------MELSAEYL -------CCCCHHHH | 12.03 | 12665801 | |
| 4 | Phosphorylation | ----MELSAEYLREK ----CCCCHHHHHHH | 13.02 | 23186163 | |
| 7 | Phosphorylation | -MELSAEYLREKLQR -CCCCHHHHHHHHHH | 15.69 | 23186163 | |
| 7 | Nitration | -MELSAEYLREKLQR -CCCCHHHHHHHHHH | 15.69 | - | |
| 26 | Phosphorylation | EHVEVEDTTLNRCSC CCEEEECCCCCCCCC | 21.48 | 27251275 | |
| 27 | Phosphorylation | HVEVEDTTLNRCSCS CEEEECCCCCCCCCE | 34.06 | 27251275 | |
| 32 | Phosphorylation | DTTLNRCSCSFRVLV CCCCCCCCCEEEEEE | 15.01 | 21712546 | |
| 34 | Phosphorylation | TLNRCSCSFRVLVVS CCCCCCCEEEEEEEE | 10.37 | 28102081 | |
| 41 | Phosphorylation | SFRVLVVSAKFEGKP EEEEEEEEEEECCCC | 20.47 | - | |
| 43 | Acetylation | RVLVVSAKFEGKPLL EEEEEEEEECCCCHH | 36.12 | 23749302 | |
| 43 | Ubiquitination | RVLVVSAKFEGKPLL EEEEEEEEECCCCHH | 36.12 | - | |
| 47 | Acetylation | VSAKFEGKPLLQRHR EEEEECCCCHHHHHH | 25.87 | 23954790 | |
| 47 | Ubiquitination | VSAKFEGKPLLQRHR EEEEECCCCHHHHHH | 25.87 | 21890473 | |
| 47 | Succinylation | VSAKFEGKPLLQRHR EEEEECCCCHHHHHH | 25.87 | 23954790 | |
| 47 (in isoform 2) | Ubiquitination | - | 25.87 | 21906983 | |
| 59 | Glutathionylation | RHRLVNACLAEELPH HHHHHHHHHHHCCCC | 2.89 | 22555962 | |
| 73 | Ubiquitination | HIHAFEQKTLTPDQW CCEEECCCCCCHHHH | 38.00 | - | |
| 74 | Phosphorylation | IHAFEQKTLTPDQWA CEEECCCCCCHHHHH | 35.24 | 23186163 | |
| 76 | Phosphorylation | AFEQKTLTPDQWARE EECCCCCCHHHHHHH | 30.01 | 21815630 | |
| 93 | Phosphorylation | K-------------- C-------------- | 27251275 | ||
| 98 | Phosphorylation | ------------------- ------------------- | - | ||
| 100 | Phosphorylation | --------------------- --------------------- | 24719451 | ||
| 109 | Acetylation | ------------------------------ ------------------------------ | - | ||
| 109 | Ubiquitination | ------------------------------ ------------------------------ | - | ||
| 113 | Ubiquitination | ---------------------------------- ---------------------------------- | 19608861 | ||
| 113 (in isoform 1) | Ubiquitination | - | 21906983 | ||
| 113 | Acetylation | ---------------------------------- ---------------------------------- | 19608861 | ||
| 139 | Ubiquitination | ------------------------------------------------------------ ------------------------------------------------------------ | - | ||
| 142 | Phosphorylation | --------------------------------------------------------------- --------------------------------------------------------------- | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BOLA2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BOLA2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BOLA2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of BOLA2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |
| "Exploring proteomes and analyzing protein processing by massspectrometric identification of sorted N-terminal peptides."; Gevaert K., Goethals M., Martens L., Van Damme J., Staes A.,Thomas G.R., Vandekerckhove J.; Nat. Biotechnol. 21:566-569(2003). Cited for: PROTEIN SEQUENCE OF 1-9, AND ACETYLATION AT MET-1. | |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-47, AND MASS SPECTROMETRY. | |
