| UniProt ID | BN3D2_HUMAN | |
|---|---|---|
| UniProt AC | Q7Z5W3 | |
| Protein Name | Pre-miRNA 5'-monophosphate methyltransferase | |
| Gene Name | BCDIN3D | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 292 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | O-methyltransferase that specifically dimethylates the 5' monophosphate of pre-miRNAs, acting as a negative regulator of miRNA processing. The 5' monophosphate of pre-miRNAs is recognized by DICER1 and is required for pre-miRNAs processing: methylation at this position reduces the processing of pre-miRNAs by DICER1. Able to mediate methylation of pre-miR-145, as well as other pre-miRNAs.. | |
| Protein Sequence | MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 98 | Phosphorylation | LPDGETCSDASREFR CCCCCCCCHHHHHHH | 43.56 | - | |
| 117 | Ubiquitination | DIDPVLVKRAEKECP CCCHHHHHHHHCCCC | 41.55 | 29967540 | |
| 133 | Phosphorylation | PDALTFITLDFMNQR CCHHHHHHHHHCCHH | 18.98 | 22210691 | |
| 143 | Ubiquitination | FMNQRTRKVLLSSFL HCCHHHHHHHHHHHH | 36.30 | 22817900 | |
| 276 | Phosphorylation | ETHPIPESLIEKGKE HCCCCCHHHHHHCCH | 29.32 | 24719451 | |
| 288 | Phosphorylation | GKEKNRLSFQKQ--- CCHHCCCCCCCC--- | 23.53 | 25056879 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BN3D2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BN3D2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BN3D2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of BN3D2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
