UniProt ID | BN3D2_HUMAN | |
---|---|---|
UniProt AC | Q7Z5W3 | |
Protein Name | Pre-miRNA 5'-monophosphate methyltransferase | |
Gene Name | BCDIN3D | |
Organism | Homo sapiens (Human). | |
Sequence Length | 292 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | O-methyltransferase that specifically dimethylates the 5' monophosphate of pre-miRNAs, acting as a negative regulator of miRNA processing. The 5' monophosphate of pre-miRNAs is recognized by DICER1 and is required for pre-miRNAs processing: methylation at this position reduces the processing of pre-miRNAs by DICER1. Able to mediate methylation of pre-miR-145, as well as other pre-miRNAs.. | |
Protein Sequence | MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
98 | Phosphorylation | LPDGETCSDASREFR CCCCCCCCHHHHHHH | 43.56 | - | |
117 | Ubiquitination | DIDPVLVKRAEKECP CCCHHHHHHHHCCCC | 41.55 | 29967540 | |
133 | Phosphorylation | PDALTFITLDFMNQR CCHHHHHHHHHCCHH | 18.98 | 22210691 | |
143 | Ubiquitination | FMNQRTRKVLLSSFL HCCHHHHHHHHHHHH | 36.30 | 22817900 | |
276 | Phosphorylation | ETHPIPESLIEKGKE HCCCCCHHHHHHCCH | 29.32 | 24719451 | |
288 | Phosphorylation | GKEKNRLSFQKQ--- CCHHCCCCCCCC--- | 23.53 | 25056879 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BN3D2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BN3D2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BN3D2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BN3D2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...